KEGG   Clostridium perfringens 13: CPE1588Help
Entry
CPE1588           CDS       T00074                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpe  Clostridium perfringens 13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPE1588 (glgB)
Enzymes [BR:cpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CPE1588 (glgB)
Exosome [BR:cpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPE1588 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1861666..1863660)
Genome map
AA seq 664 aa AA seqDB search
MGGKEMRNCKELKHEKNGNVTEKVGKNKGKSKKVSKDESLLSFDLFLEGKEHSAYKFMGA
HFITENRKRGVRFTTWAPRASKIYVIGDFNNWELKEEYSMKKINERGIWSLFLPKLEEGI
KYKFAVVNECGNNTVYKADPYAFKSELRPNTASVLTKIKSFRWGDKRWLNKREKEGLDNK
PMNIYELHLGSWKRKDGEFMTYEEISEVLVEYIKEMGYTHVEFMPINEHPLDASWGYQGV
GYYSVTSRYGDLNGLKTLINKLHKNNIGVLLDWVPSHFCKDEHGLFMFDGSPTYEYEAWW
KANNEGWGTCNFDLGRPEVKSFLFSNAMYWINEFHVDGLRVDAVSNMLYLDYGREYGEWE
PNIYGGNGNLEAIAFLKELNTIIKKEGKGAITVAEESTSWEGITKPVEEDGLGFDYKWNM
GWMNDTLSYIELDPIYRKYHHNKMNFSMMYNYSEKFILPISHDEVVHGKKSLINKMWGDD
WKKYAGLRVYASFMMGHPGKKLMFMGCEFGQFVEWREWEELQWNVIEEFDIHRKTKEYFK
ALNKFYLENSSLWSLDYEEEGFKWIDADNSEESVLSFIRIGKNKKEKLIFICNFTPEVYY
DFKVGVPELGEYVEAFNSDALEFGGAGNIVGDSILKATEESFKDFDYSISVKVPPLGTLV
LKVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggggggaaaagagatgagaaattgtaaagaacttaagcatgagaaaaatggtaacgtt
accgaaaaagtggggaaaaacaaaggaaaaagcaaaaaagtgtctaaagatgaaagctta
ttaagctttgatttgtttttagagggaaaagaacattcagcttataagtttatgggagct
cattttataactgaaaatagaaaaaggggtgtaagatttactacttgggctccaagggct
agcaaaatatatgttataggtgattttaataattgggaattaaaagaagaatactccatg
aaaaaaattaatgaaagaggaatatggagtttatttcttcctaaattagaagagggtata
aagtataaatttgcagtagtaaatgaatgtggaaataatacagtatataaggctgaccca
tatgcatttaaatcagaattaagacctaatacagcctctgtacttactaaaattaagagt
tttagatggggagataagagatggcttaataaaagagaaaaagaaggtttagataataaa
cctatgaatatatatgaacttcatttagggtcttggaagagaaaagatggagagtttatg
acctatgaagaaataagtgaagtgctagtagaatatataaaagagatgggatatacccat
gttgagttcatgcctataaatgaacatcccttagatgcttcttggggatatcaaggagta
gggtattactcagttacaagtagatatggagatttaaatggattaaagactcttataaat
aaacttcataaaaataatattggagtattactagattgggtacctagccatttttgtaag
gatgagcatggattatttatgtttgatggatcaccaacctatgaatatgaggcttggtgg
aaggctaataatgaaggatggggaacttgtaattttgatttaggaagaccagaggttaaa
tcctttttattttctaatgctatgtactggataaatgaatttcatgtagatggattaaga
gtagatgcggtatctaatatgctttatttagattatggaagagaatatggagaatgggag
ccaaatatctatggaggaaatggaaaccttgaagctattgcctttttaaaagaactaaat
acaattataaaaaaagaaggaaaaggagcaattacagtagctgaagaatcaacctcatgg
gaaggaattactaaacctgttgaagaggatggattaggatttgattataaatggaatatg
ggatggatgaatgataccttaagttatattgagttagatccaatatatagaaagtatcat
cacaataaaatgaacttttcaatgatgtacaattattcagaaaagtttattctaccaatt
tcacatgatgaggttgttcatggtaagaaatctcttataaataaaatgtggggagatgat
tggaaaaagtatgcaggactaagagtttatgcttcttttatgatgggacacccagggaaa
aaattaatgtttatgggctgtgaatttggtcagttcgttgaatggagagaatgggaagaa
cttcaatggaatgttattgaagaatttgatatacacagaaaaaccaaggagtattttaaa
gcattaaataaattttatttagagaatagttctttatggtcacttgattatgaagaagaa
ggctttaaatggattgatgctgataattcagaagaaagtgtactttcatttataagaatt
ggaaagaataaaaaggaaaaattaatatttatatgtaattttactccagaggtttattat
gattttaaagtaggggttccagaacttggagaatatgttgaagcctttaattcagatgcc
ttagaatttggaggggcaggaaatattgtgggagatagtattttaaaagccacagaggaa
agttttaaagattttgattattcaataagtgttaaggtacctccattaggaactttagtt
ttgaaagtaaaataa

DBGET integrated database retrieval system