KEGG   Clostridium perfringens 13: CPE1694Help
Entry
CPE1694           CDS       T00074                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpe  Clostridium perfringens 13
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpe00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1972918..1974072)
Genome map
AA seq 384 aa AA seqDB search
MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTLDIIKEFSPKYVAINHEE
SYKKLVDLVKSEGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKDI
ALANKETLVVAGELVMREAKENGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPF
RGFTIEDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCSYKDIEVVV
HPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNREGNISEKLDLFKIRELTFEKP
DLDTFKCLKLAYEAGEKGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYN
KEVTLDNVINLDKEVRQYIYEKYN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatatctatactaggggtaacaggttctataggaactcaaactttagatgta
ttaagatttcataaagaagattttgaattagttggtataacagctaatagaaatatagaa
ttaacattggatataataaaagagttttcacctaaatacgttgcaataaatcacgaagaa
tcttataaaaagcttgtagatttagtaaaaagcgaaggattaaaatgtgaagttatctat
ggtatggaaggattagttaaagttgctactttagatgaaattgatatagttgttacttct
gttgttggtatgattggattaaaaccaactgtagaagctataagaaaaggaaaagatatc
gctttagcaaataaagaaactttagtagtagcaggtgaacttgttatgagagaagctaaa
gaaaatggagtgaaaatacttccagtagactcagagcatagtgctatattccaatcatta
caaggaaatgctcataacaaaattgataaaatacttttaactgcttctggaggacctttt
agaggatttactatagaagatttaaaatcagtaactccagaaagagctcttaagcatcca
aaatggaatatgggtcaaaaaatatcaatagattcatcaactctaatgaacaagggatta
gaagttatagaagctcattggttatttgattgttcttataaagatatagaggttgtagtt
catccacaatcaataatacattctatggttcaatatactgatggagcagttatagctcaa
ttaggtgtaccagatatgaaattaccaattcaatatgctttaaattatccaaatagggaa
ggaaatattagtgaaaagttagatttatttaagattagagagttaacttttgaaaagcca
gatttagatacatttaaatgcttaaaattagcttatgaagcaggagaaaagggaaagctt
atgccaacaatcttaaatggtgcaaatgaagtatgtgttgaactattcctaaataaaaag
ataacatatctgcaaataccagagataatagaagagtgtatgaatacttttgattacaac
aaagaggttactcttgataatgtaataaatttagacaaagaagtaagacagtatatatat
gaaaaatataactag

DBGET integrated database retrieval system