KEGG   Clostridium perfringens 13: CPE1694Help
Entry
CPE1694           CDS       T00074                                 

Definition
(GenBank) 1-deoxy-d-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00900  Terpenoid backbone biosynthesis
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPE1694
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CPE1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 Glu_dehyd_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAB81400
UniProt: Q8XJR1
Position
complement(1972918..1974072)
Genome map
AA seq 384 aa AA seqDB search
MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTLDIIKEFSPKYVAINHEE
SYKKLVDLVKSEGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKDI
ALANKETLVVAGELVMREAKENGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPF
RGFTIEDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCSYKDIEVVV
HPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNREGNISEKLDLFKIRELTFEKP
DLDTFKCLKLAYEAGEKGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYN
KEVTLDNVINLDKEVRQYIYEKYN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatatctatactaggggtaacaggttctataggaactcaaactttagatgta
ttaagatttcataaagaagattttgaattagttggtataacagctaatagaaatatagaa
ttaacattggatataataaaagagttttcacctaaatacgttgcaataaatcacgaagaa
tcttataaaaagcttgtagatttagtaaaaagcgaaggattaaaatgtgaagttatctat
ggtatggaaggattagttaaagttgctactttagatgaaattgatatagttgttacttct
gttgttggtatgattggattaaaaccaactgtagaagctataagaaaaggaaaagatatc
gctttagcaaataaagaaactttagtagtagcaggtgaacttgttatgagagaagctaaa
gaaaatggagtgaaaatacttccagtagactcagagcatagtgctatattccaatcatta
caaggaaatgctcataacaaaattgataaaatacttttaactgcttctggaggacctttt
agaggatttactatagaagatttaaaatcagtaactccagaaagagctcttaagcatcca
aaatggaatatgggtcaaaaaatatcaatagattcatcaactctaatgaacaagggatta
gaagttatagaagctcattggttatttgattgttcttataaagatatagaggttgtagtt
catccacaatcaataatacattctatggttcaatatactgatggagcagttatagctcaa
ttaggtgtaccagatatgaaattaccaattcaatatgctttaaattatccaaatagggaa
ggaaatattagtgaaaagttagatttatttaagattagagagttaacttttgaaaagcca
gatttagatacatttaaatgcttaaaattagcttatgaagcaggagaaaagggaaagctt
atgccaacaatcttaaatggtgcaaatgaagtatgtgttgaactattcctaaataaaaag
ataacatatctgcaaataccagagataatagaagagtgtatgaatacttttgattacaac
aaagaggttactcttgataatgtaataaatttagacaaagaagtaagacagtatatatat
gaaaaatataactag

DBGET integrated database retrieval system