KEGG   Clostridium perfringens 13: CPE1862Help
Entry
CPE1862           CDS       T00074                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpe  Clostridium perfringens 13
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cpe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2130930..2132384)
Genome map
AA seq 484 aa AA seqDB search
MILKSLLKGLDYEVIKGNEESKVQNIRYDNRKIEQGDAFVCVKGFKVDGHSFIGDAIKKG
AKTLIVQEDVSVQEDITIIKVRDTRKALAIMSSNYFGNPKDKLKIIGITGTNGKTTSAFI
IKSILEKAGFMTGLIGTIANYIGNKKVDAVRTTPESYELHELFKNMVDAGVEYCVMEVSS
HSLELDRVYGIQFEEGIFTNLTRDHLDFHKTFENYYNAKFKLFERSNHSIINLDDPYGAN
IVKDIEERGVKTKVSTFSIEKESDFKAFEIKSHSNGSEFKVNLEGIEEFSINIPGEYNIY
NSLGCIICAYNLNIPMDKIKEGLSDVVIPGRCELVAKEKNLPYSIIIDYAHTPDGLENIL
STVKAFTKNRMISVFGCGGDRDKVKRPQMGKIGCELSDIAIITSDNPRSEEPMDIINDIV
KPLNYDNFVIEVNRKEAIRKAMNMALEGDVIVIAGKGHETYQILKDETIHFDEREVVYDI
LEGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattcttaaaagtttattaaagggcttagattatgaagttataaaaggtaatgaagag
tcaaaagtacaaaatataagatatgataacagaaaaatagaacaaggggatgcctttgtt
tgtgtaaaaggctttaaagtagatggacattcctttattggtgatgctattaaaaaagga
gctaagacattaatagttcaagaagatgtaagtgttcaagaagacataacaataataaag
gttagagacactagaaaagccttggcaataatgtcttcaaattattttggaaatccaaag
gataaacttaaaataataggaataacaggaactaatggtaaaaccacttctgcttttatt
attaaatctatcttagaaaaggcaggatttatgactggtttaataggaaccatagcaaac
tatataggaaataaaaaagtagacgcggtaagaactacaccagaatcttacgagcttcat
gagctatttaaaaatatggttgatgctggagtagaatattgcgttatggaagtttcatcc
cactctctagagttagatagagtatatggaattcaatttgaagaaggaattttcactaat
ttaactagagatcatttagattttcataaaacctttgaaaactattataatgctaaattt
aagctttttgaaagaagtaatcatagtatcataaacttagatgatccatatggagctaat
atagttaaggatatagaagaaagaggagtaaagactaaggtttctactttttcaattgaa
aaagagtcagactttaaggcttttgagattaaaagtcactcaaatggttcagaatttaag
gtgaatttagaaggtatagaagaattttctataaacattcctggagaatacaatatatat
aactcattaggttgtataatatgtgcatataacttaaatattccaatggataaaattaaa
gaaggattaagtgatgtggttataccaggaagatgtgagttagtagcaaaggagaaaaat
ttaccttatagcataataatagattatgcacacacaccagatggattagaaaatatttta
agtacagtaaaggcctttactaaaaatagaatgatttctgtatttggttgtggaggagat
agagataaggttaagcgtcctcaaatgggtaaaataggatgtgaattatcagatattgca
ataattacttcagataatccaagaagtgaggagcctatggatataattaatgacatagta
aaaccacttaattatgataactttgttattgaagttaatagaaaagaagctataagaaaa
gcaatgaatatggctttagagggagatgttattgttatagctggtaaaggacatgaaaca
tatcaaatactaaaggatgaaacaatacactttgatgaaagagaagttgtatatgatatt
ttagaaggcaagtag

DBGET integrated database retrieval system