KEGG   Clostridium perfringens 13: CPE1948Help
Entry
CPE1948           CDS       T00074                                 

Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpe  Clostridium perfringens 13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPE1948
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPE1948
DNA repair and recombination proteins [BR:cpe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CPE1948
    RecFOR pathway proteins
     CPE1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2231145..2231750)
Genome map
AA seq 201 aa AA seqDB search
MYEYIRGQFQGISKDYVVIELNNIGYKIFTSGNTMSNMPKVGDEVLLYLEQIVREDFIGL
YGFTTREELEMFKLLLSINGVGAKAALSLLSISTVNNLKYAIMMGDEKHITRAPGIGKKT
AQRIILELKDKLKPDELTSEEGQLIEGINDNSDYSFNINETLSALMALGYTEKEAQKALE
KVDKTLSIENMIKESLKLLMR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatataagaggccaatttcaagggataagtaaggattatgttgtaatagaa
ttaaataatataggatataaaattttcacatctggaaatacaatgtctaatatgccaaaa
gtgggagatgaagttcttctatatctagagcagatcgttagagaagatttcataggtcta
tatggatttacaacaagagaagaattagaaatgtttaagcttttattatccataaatgga
gtaggagcaaaagctgctttatcacttttatccattagtactgttaataatttaaagtac
gcaataatgatgggagatgaaaagcatataacaagagcacctggaataggaaagaaaacg
gctcaaagaattattctagagcttaaggataagttaaaaccagatgaacttacttctgaa
gagggacaattaatagaaggaattaatgataattctgattatagtttcaatataaatgaa
acattaagtgccttaatggcattaggatatacagagaaggaagctcaaaaagctttagaa
aaagttgataagacattatctatagaaaatatgataaaggagtctttaaaacttttaatg
cgttag

DBGET integrated database retrieval system