KEGG   Clostridium perfringens 13: CPE1948Help
Entry
CPE1948           CDS       T00074                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpe  Clostridium perfringens 13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPE1948 (ruvA)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPE1948 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2231145..2231750)
Genome map
AA seq 201 aa AA seqDB search
MYEYIRGQFQGISKDYVVIELNNIGYKIFTSGNTMSNMPKVGDEVLLYLEQIVREDFIGL
YGFTTREELEMFKLLLSINGVGAKAALSLLSISTVNNLKYAIMMGDEKHITRAPGIGKKT
AQRIILELKDKLKPDELTSEEGQLIEGINDNSDYSFNINETLSALMALGYTEKEAQKALE
KVDKTLSIENMIKESLKLLMR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatataagaggccaatttcaagggataagtaaggattatgttgtaatagaa
ttaaataatataggatataaaattttcacatctggaaatacaatgtctaatatgccaaaa
gtgggagatgaagttcttctatatctagagcagatcgttagagaagatttcataggtcta
tatggatttacaacaagagaagaattagaaatgtttaagcttttattatccataaatgga
gtaggagcaaaagctgctttatcacttttatccattagtactgttaataatttaaagtac
gcaataatgatgggagatgaaaagcatataacaagagcacctggaataggaaagaaaacg
gctcaaagaattattctagagcttaaggataagttaaaaccagatgaacttacttctgaa
gagggacaattaatagaaggaattaatgataattctgattatagtttcaatataaatgaa
acattaagtgccttaatggcattaggatatacagagaaggaagctcaaaaagctttagaa
aaagttgataagacattatctatagaaaatatgataaaggagtctttaaaacttttaatg
cgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system