KEGG   Clostridium perfringens 13: CPE1995Help
Entry
CPE1995           CDS       T00074                                 

Definition
(GenBank) probable glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00220  Arginine biosynthesis
cpe00250  Alanine, aspartate and glutamate metabolism
cpe00471  D-Glutamine and D-glutamate metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPE1995
   00220 Arginine biosynthesis
    CPE1995
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CPE1995
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CPE1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: BAB81701
UniProt: Q8XIW8
Position
complement(2286083..2287000)
Genome map
AA seq 305 aa AA seqDB search
MKNFLESLIENNRQYVEHGKLASYIPELEKANKEDLGIYIVTLDGKEVGAGEYDKKFTIQ
SISKVITLMLAILDNGKDRVFSRVGVEPTGDSFNSIVSLERKPSKKPFNPMVNSGAILTT
SLIEGDSEEEKFERILEFTRKVTGNDDIQLNEDVYLSEKETGDRNRALAYFMKSNGVIEG
NIDDILDLYFKQCSLEVNAKDLARFGAMLANDGVLPWNGERVISREICRIIKTIMVTCGM
YDDSGKFAVHIGIPAKSGVGGGIMAAVPRRMGIGIFGPSLDDKGNSIAGTHVMKDLSEEL
DLSIF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattttcttgagagtttaatagaaaataatagacaatatgttgaacatggaaaa
ctggcatcttatattccagaattagaaaaagcaaataaagaagatttaggtatatatata
gttactcttgatggaaaagaggtaggggcaggagagtatgataaaaagtttactattcag
agtatatcaaaagtaataactttaatgcttgcaatattagataatggaaaagatagagta
ttttcaagagtaggtgttgaaccaactggagatagctttaatagtatagtaagtttagag
agaaagccctctaaaaaaccttttaaccctatggttaattcaggggctatattaacaaca
tctttaattgaaggtgatagtgaagaggaaaagtttgagagaattttagaatttactaga
aaagtaacaggaaatgatgatattcaattaaatgaagatgtttatttatctgaaaaggaa
actggagatagaaatagagccttagcatactttatgaaaagtaatggagttatagaagga
aatatagatgatatattagatttatatttcaaacaatgttctctagaagttaatgctaaa
gatttagctagatttggtgctatgcttgctaatgatggagtattaccttggaatggagaa
agagtaatatctagagaaatttgcagaataataaaaacaataatggttacttgcggtatg
tatgatgactcaggtaaatttgctgtacatataggaattccagcaaaaagtggagttggt
ggcggaataatggctgctgttccaagaagaatgggaataggtatttttggaccttcttta
gatgataagggaaatagtatagcaggaacacatgttatgaaggatttatctgaggaatta
gatttaagtattttctaa

DBGET integrated database retrieval system