KEGG   Clostridium perfringens 13: CPE2175Help
Entry
CPE2175           CDS       T00074                                 

Gene name
recD
Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpe  Clostridium perfringens 13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPE2175 (recD)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPE2175 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2494907..2497141)
Genome map
AA seq 744 aa AA seqDB search
MEALNGIVESIVFKSSDTGYTVIKFRENNIIHTAVGVLPHVKEGQNLKITGSWVNHSQFG
KQFKVEECEEILPTSKDGIEKYLSSGIIQGIGPVTAKKIVNKFGEDTLNILDNNIERLKE
IEGIGKKKLETIIESYREQRELKNITIFLQTHGLSVNQCLKIYKKYGASSVDTVKNNPYI
LCDEISGIGFKTSDKIARSLGIEIDSPFRIQSGIRYVINEFCANGHTFMPKDELIKEASN
VLTVSGDIIEENIKNAALDRKIKLERVNDKEGVFTIPNYYCELGITNRILTLAISNFQDI
SVDVDHLILQFEKKNNITFAESQKDAIISAFQNGIEIITGGPGTGKTTIIKCIIEIFETC
GLKVLLGAPTGRAAKRMSESTGKEATTIHRMLDMGVFEKEESVFVTNAEEHSLEADVVII
DEASMIDITLMNALLKSIKVGTRLIIVGDVDQLPSVGAGNVLNDFIESGFTKVVRLKEIF
RQGKESMIVVNAHKINKGEMPKLNEKGTDFFFIRNDIQEGILNTIIDLINTRLPKFNSNW
DKLKSIQVLVPMKKGVLGVTNLNERIQNVLNPKAPYKKEKEFRSMVFREGDKVMQIKNNY
SLKWTRIAGKGEHEGLGVFNGDMGFIESIDLEGKKLSIIFDDERRVIYDFMYLDELDLAY
AITIHKSQGSEFPVVIIPAYMGAPLLMNRNLLYTGITRAKEMVVVVGIPKALKYMVDNTR
SMERYSSLNWRIKEVISNEVFEQD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattaaatggaatagttgagagtatagtatttaaaagctcagatacaggatat
acagttataaaatttagagaaaataatattattcatacagcagtgggagttttaccacat
gtaaaagaaggtcaaaatttaaaaattacaggaagttgggttaaccattcccagtttgga
aaacaatttaaagtagaagaatgtgaagagatattacctacttcaaaggatggaatagaa
aaatatttatcttctgggataatacaggggataggacctgttacggcaaaaaaaattgta
aataaatttggagaagatactcttaatattttagataataatattgagagattaaaagaa
atagaaggaataggtaaaaagaagttagagaccataattgagtcttatagagaacaaaga
gaattaaaaaatataactatatttttgcaaacccatggattaagtgtaaatcaatgtttg
aagatttataaaaaatatggggctagttcagttgatacagttaaaaataatccatatata
ctttgtgatgaaatttcaggaataggatttaagacttctgataagattgctagaagttta
ggaatagaaattgattcaccttttagaattcaaagtggtataagatatgtaataaatgaa
ttttgtgctaatggtcatacatttatgccaaaggatgaacttataaaggaagcaagtaat
gtattaactgtaagtggagatataatagaagaaaatattaaaaatgcagctttagataga
aagataaagttagagagggttaatgataaagaaggtgttttcacaatacctaattattat
tgtgagcttggaataactaataggattttaactttagctataagcaatttccaggatata
agtgtagatgtagatcacctaatacttcaatttgaaaagaaaaataatataacttttgca
gaatcacagaaagacgctataataagtgcttttcaaaatggtatagagataataactggg
ggaccaggaacaggaaagaccactataataaagtgtataattgaaatttttgaaacttgt
ggtttgaaggttcttttgggagcacctactggaagagcggctaaaagaatgagtgagtct
acaggaaaagaagctaccacaatacatagaatgcttgatatgggagtctttgaaaaagaa
gaaagtgtttttgtaaccaatgcagaggaacattccttagaggctgatgtggttataata
gatgaggcatcaatgattgatataactttaatgaatgctttacttaaatctattaaggta
ggtactaggcttataatagtgggagatgttgatcagcttccatcagtaggagctggaaat
gtattaaatgattttatagagagtggatttacaaaggttgtacgtctaaaggaaatattt
agacaaggaaaagagagtatgattgtagtaaatgcacataaaataaataaaggtgagatg
cctaagttaaatgaaaaaggtactgatttcttcttcataagaaatgatattcaagaggga
atattaaatactattatagatttaataaatactaggttgcctaagtttaactcaaattgg
gataaattaaaaagtatacaggttttagttcctatgaaaaagggtgtattaggagttaca
aatttaaatgaaagaattcaaaatgtcttaaacccaaaggctccatataaaaaagaaaaa
gaatttagaagtatggtatttagagagggagataaggttatgcagataaagaataactac
tctctaaaatggaccagaatagctggaaaaggtgagcatgaaggcttgggtgtatttaat
ggagatatgggatttatagaaagtatagatttagaaggaaaaaaactatctataatcttt
gatgatgaaagaagagttatttatgattttatgtatttagatgaattagatttagcttat
gcaattacaatacataaaagtcaaggaagtgaattccctgtagtaataatacctgcatat
atgggtgcaccattacttatgaatagaaatttattatatacgggaataactagggcaaaa
gaaatggttgtagtagttggaatacctaaagcattaaaatatatggttgataatacaagg
agtatggagcgttattcctctttaaattggagaataaaagaagtaatatctaatgaggtt
tttgaacaagattaa

DBGET integrated database retrieval system