KEGG   Clostridium perfringens 13: CPE2338Help
Entry
CPE2338           CDS       T00074                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpe  Clostridium perfringens 13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2692463..2693956)
Genome map
AA seq 497 aa AA seqDB search
MRRASGIIMHIASLPGKYGIGTFGKEAFEFVDFLKKAGQGYWQILPLGPTSYGDSPYQSF
SAFAGNPYFIDFDILNKEGLLDKKDYQGINFGNDPEKIDYALLFDKKMRVLRIAYEKSLD
KNKEEIEKFREENKLWLEDYALYMAIKNENELVSWQEWDEKLRLRDKKTLEEYKVKLEKE
INYWVFLQYHFFKQWNKLKEYANSFGIKIIGDMPIYVAEDSADVWANPKAFLLDENNIPK
KVAGCPPDAFSETGQLWGNPIYDWNYMDDTGYSWWIDRVRESFKLYDILRIDHFRGFEAY
WQIPYGDETAVNGEWVKGPGIKLFNAIKEELGEVNVIAEDLGYLTQEVIDFRNETGFPGM
KVLQFAFDSREESDYLPHNYPVNSISYTGTHDNDTFRGWFEVTGNREDVEYSKKYLKLTE
EEGYNWGFIRGVWSSVSHTAIALMQDFLNLGNEARINYPSTLGGNWQWRVKDDALTDELA
EKIYDITKLYGRVNINE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagcaagtggaataataatgcatattgcttccttacctggaaagtatggaata
ggtacttttggtaaggaagcatttgagtttgtagattttttaaagaaagctggacaagga
tattggcaaatattgcccttaggtcctacgagttatggtgattcaccatatcaatcattt
tcagcctttgcaggaaatccatattttatagattttgatattttaaataaagaaggatta
cttgataaaaaagattaccaaggaattaattttggaaatgacccagaaaaaatagattat
gctttattatttgacaagaagatgagagtattaagaatagcatatgaaaaatctttagat
aaaaacaaagaagaaattgaaaagtttagagaagaaaataaactttggcttgaagattat
gctttatatatggcaatcaaaaatgaaaatgaattagtaagttggcaagaatgggatgaa
aaattaagattaagagataaaaagaccttagaagaatataaagttaaattagaaaaagaa
ataaactactgggtattcttacaatatcatttctttaagcaatggaataaattaaaagag
tatgcaaatagttttggaattaagataattggagatatgcctatatatgttgcagaggat
agtgcagatgtttgggcaaatccaaaagcatttttattagatgaaaataatattcctaaa
aaggttgctggatgtccacctgatgctttttcagaaacaggtcaattatggggaaatcct
atatatgattggaattacatggatgatacaggatattcttggtggattgatagagtaaga
gaaagctttaagctttatgacatattaagaatagaccattttagagggtttgaagcttac
tggcaaataccatatggagatgaaactgctgtaaatggtgagtgggttaaaggccctgga
ataaaattatttaatgcaattaaagaagagttaggagaggtcaatgtaatagcagaagac
cttggttatttaactcaagaggttatagattttagaaatgaaactggattcccaggaatg
aaggttttacaatttgcctttgattctagggaagaaagtgattatcttccacataattat
ccagttaactcaatatcttatacaggtactcatgataatgatacatttagaggttggttt
gaagttacaggaaatagagaagatgtggaatattctaaaaaatatttaaaacttactgaa
gaggaagggtataactggggatttatcagaggagtttggagcagtgtatcacatacagcg
atagctctaatgcaagatttcttaaacttaggaaatgaggcaagaataaactatccatct
actcttggtggcaattggcaatggagagttaaagatgatgctctaactgatgaattagca
gagaaaatatatgatataacaaaattatatggaagggtgaatattaatgaataa

DBGET integrated database retrieval system