KEGG   Clostridium perfringens 13: CPE2552Help
Entry
CPE2552           CDS       T00074                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2922805..2924307)
Genome map
AA seq 500 aa AA seqDB search
MKKYIVALDQGTTSSRAIIFDKEQNIIGVSQKEFNQIYPREGWVEHDPMEIWATQYSVLQ
EVMAKCNITQENIAAIGITNQRETTIVWDKNTGVPIYNAIVWQCRRTADICDELKERDGL
VDYIRENTGLVLDAYFSGTKIKWILDNVEGAREKAEKGELLFGTVDSWLVWKLTNGKVHV
TDYTNASRTMIFNIKNLQWDERMLKELDIPRSMLPEVKNSSEIYGYANLGAKGGIRVPIA
GIAGDQQAALFGQAAFNKGDVKNTYGTGCFLLMNTGEELVKSKSGLLTTIAIGLHGKVQY
ALEGSVFVGGAVIQWLRDELRIISDSSDTEYFATKVEDNGGVYVVPAFVGLGAPYWDMYA
RGTIVGLTRGTNRNHIIRAALESIAYQTRDVLEAMINDVGYDINCIKVDGGASRNNFLMQ
FQSDLVGKKVIKPIITETTALGAAYLAGLAVGYWSDKEEIAKLWFASEEFEPTISEERRN
KYHKKWKKAVERSKGWALED
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatatagtagcattagatcaaggaacaacaagctctagagcaataattttt
gataaagaacaaaatattattggggtaagccaaaaggaatttaatcaaatttatcctaga
gaaggatgggttgagcatgatccaatggaaatatgggcaactcaatatagtgtacttcaa
gaagttatggctaaatgtaatataactcaagaaaatatagcagccattggaataactaac
caaagagaaactacaatagtttgggacaaaaatacaggggttccaatatacaatgcaatt
gtttggcaatgtagaagaactgctgatatatgcgatgagttaaaagaaagagatggactt
gtagactatattagagaaaatacaggacttgtacttgatgcatatttttcaggaacaaaa
ataaaatggatattagataatgttgaaggtgcaagagaaaaagctgaaaagggtgagctt
ttatttggtacagtagatagttggcttgtttggaagcttacaaatggaaaagttcatgta
actgattatactaatgcatctagaactatgatatttaacataaagaaccttcaatgggat
gaaagaatgttaaaggaactagacattcctagaagtatgttaccagaagtaaaaaattca
tctgaaatttacggatatgcaaaccttggagcaaaaggtggaataagagttcctatagct
ggaatagctggggaccaacaagctgctttatttggacaagctgcatttaataaaggtgac
gtaaaaaatacttatggaacaggatgtttcttattaatgaacacaggagaagaacttgtt
aaaagtaaatcaggacttttaacaacaatagctattggattacacggaaaagttcaatat
gctttagaaggatcagtatttgttggaggagctgttatccaatggcttagagatgaatta
agaataataagtgattctagtgatactgaatactttgctacaaaggtagaagataatggt
ggagtatatgttgttcctgccttcgttggattaggagctccttattgggatatgtatgct
cgtggaactatagtaggattaacacgtggaactaatagaaatcatataataagagcagca
cttgaatcaattgcatatcaaacaagagatgtgcttgaagctatgataaacgatgttgga
tatgatataaattgtataaaagtagatggaggagcaagtagaaataatttcttaatgcaa
ttccaatcagatttagttggtaaaaaggtaattaagcctataattacagaaacaacagct
ttaggagctgcttaccttgcaggactagcagttggttactggagtgataaagaagaaata
gctaagttatggtttgcaagtgaagaatttgagccaactatttctgaagagagaagaaat
aaatatcataagaaatggaaaaaggctgttgaaagatcaaagggatgggcacttgaagat
taa

DBGET integrated database retrieval system