KEGG   Chlamydia pecorum P787: CPE3_0836Help
Entry
CPE3_0836         CDS       T02853                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpec  Chlamydia pecorum P787
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPE3_0836 (hemG)
Enzymes [BR:cpec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CPE3_0836 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951377..952648
Genome map
AA seq 423 aa AA seqDB search
MKNIIVIGSGISGLSSAWWLQKKFPSAHILILEKAPSPGGLLHTKKCEEFLFDLGPKGFL
TRGEGLFTLKLIDELGLNEALIFSDKTAKNRYIHYKGKTKKISLWSLLQEGLLTALMKDF
FAPRNPNDSSVEAFLQRHSSQNLTKHILNPIITAIRAGKSPHLSTYMAFPSLAKREAETG
SLLKSALKEMLFPSHAKGTYSLATLKPSLHLLIETLIKKLSATWRFSSPVIQIHASSDQV
QITTPSETLSADLAIYTGPLHLLPSLTDLPSIHRMTEKLTPWHFSSTALGWRSANFSLPK
GYGMLFAEVPPLLGIVWNSQIFPQRAPGTTSLSLLLEGYWHEEDAYACSIATISEYLGIF
QKPDAFALFSPSDGVPQHNVGFFKAKQQILPSLPKTLKLAGQNIAGPGLNRCIASAFKTV
SSL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattattgttataggatcgggaatctcaggactttcctctgcatggtggctg
cagaaaaagttcccctctgcccatattcttatccttgaaaaagcgccttctcctggaggg
cttttacacaccaaaaaatgcgaagaatttctctttgacttaggccctaaaggatttctt
acccgaggagaagggttattcaccttaaagttaatcgatgagctaggccttaatgaagca
ctcatctttagcgacaaaactgccaagaaccgctacattcactataaagggaaaacaaag
aaaatctctctatggtcgttgctgcaagaaggtctcctaacagccttaatgaaagatttt
ttcgcccctcgcaaccctaatgatagctctgtggaggccttcttacaacgccacagctcg
caaaatcttacaaaacatattttaaatccaataattactgcgatacgtgcagggaaaagc
ccccatctctccacatacatggccttcccctccttagcaaaacgcgaagcagaaacaggc
tctctcttaaaaagtgcccttaaagaaatgctctttccttctcatgctaaagggacatac
tccctagcaactctaaaaccttccttgcatctccttattgagactcttataaaaaaactc
tctgcaacatggaggttttcttctccagtaatacaaatccacgcctcttcggatcaagtg
cagatcacaactccttcggaaacactctccgcagatcttgctatctataccggccctttg
catctccttccctccctaacggatcttcctagcatacacagaatgacagaaaaactcact
ccctggcacttctctagcacagcattaggatggcgctctgcgaacttctctcttcccaaa
gggtatggtatgctctttgctgaagtcccccctctcttggggatagtatggaactcacaa
attttcccccagcgcgctccaggaacaacctctctttctctactcctcgagggatactgg
catgaggaagatgcctatgcttgttctattgcgacaatttctgaatacctagggatcttt
caaaaacctgatgcctttgcattattttctccctcagatggcgtcccccaacataatgta
ggattctttaaagccaaacagcagatcttgccttctctgccgaaaactctcaagcttgca
ggtcaaaacatcgctggtcctgggttgaaccgttgcatcgcctcagcgtttaaaactgta
tcctctctttaa

DBGET integrated database retrieval system