KEGG   Chlamydia pecorum PV3056/3: CPE1_0441Help
Entry
CPE1_0441         CDS       T02854                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpeo  Chlamydia pecorum PV3056/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpeo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPE1_0441 (malQ)
Enzymes [BR:cpeo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CPE1_0441 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484733..486307)
Genome map
AA seq 524 aa AA seqDB search
MKLFHSIETSPAASSWKLLGTTPKHGICVPLFSLHTKNSCGIGEYLDLLPLISWCASSGF
HILQLLPLNDTGEDSSPYNSISSIALNPLFLSLTALPEVHSLPKSKEKLRAMHKLCDLPH
VSYPKVKQAKWEFLREYYTQIGKASSADNPEFHKFIDKESSWLSPYALFRAIKHHMNGTP
STTWPISLTDQKQFPQLAKTFSSEIHFFSYLQFLCYQQLSQVRTFADQHQVFLMGDLPIL
ISKDSCDVWYAKEYFSSSGSVGAPPDFYNAEGQNWQLPIYNIENLKKDNYIWWKERLRYA
ENFYSLYRLDHIVGFFRLWVWDSQGNGKFFPESPKEYLKQGTEILSSLLQDSSMLPIGED
LGDVPKDIKKRLKTLGICGTRIPRWEKYWESGEGFIPFDKYCPLSMTSLSTHDSDTLALW
WNNSPSEAKEFASFLNLPYSSKLTVETQKTILNLSHQTASIFHINLLNDYLALCPELISK
QLYQERINVPGTLSHTNWIYRVRPSMEELSSHERFNHYIKEILP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcttccattccatagaaacatccccagcagcttcctcatggaaactcctaggg
accactccaaaacacggcatttgcgttcctttattttctcttcatacaaaaaatagctgc
ggcatcggagaatacctagaccttcttcctcttatctcttggtgtgcctcttcaggtttc
catatccttcagctccttcctctaaacgatacaggagaagatagcagcccatacaatagc
atctcctcaatcgctttaaatcccctatttctttctctaacagcactccccgaagtccac
tctctccctaagtctaaggaaaaacttcgagccatgcataaactctgtgacttacctcat
gtttcctatcctaaagtaaaacaggcaaaatgggagtttcttagggaatattatacccaa
ataggaaaagcctctagtgctgacaatccagagttccataagtttatagataaagagtcc
tcctggctctctccctatgcactgtttcgagcaatcaaacaccatatgaatgggactcca
agcacaacatggcccatctcattgacagatcaaaaacagtttcctcaattagcaaaaacc
ttttcctctgagatacattttttttcttatctacagtttctctgttaccaacaactctcc
caggtacgtacctttgctgatcaacaccaagtctttcttatgggagatcttcctatttta
atcagtaaggatagctgcgatgtgtggtatgctaaggagtatttctcttcatcaggatct
gtaggtgcccctccagatttttacaacgccgaagggcaaaactggcagctgcctatctac
aacatagaaaatcttaaaaaagataactatatctggtggaaggagcgcttacgctacgca
gaaaacttttattctctataccgtcttgatcatattgtaggattctttcgcttatgggta
tgggactctcaaggaaacgggaagttcttcccagaatctcctaaagaatacctaaagcag
ggaaccgaaatcctctcttctttacttcaagattcctccatgctccctattggtgaggat
cttggagatgtccctaaagatatcaaaaagaggctaaaaactttgggaatttgtggaaca
cgcattcctagatgggagaagtattgggaatctggagaaggatttattccctttgataag
tattgtcctctatccatgacttccttatccacgcatgattccgataccttagcactgtgg
tggaataactccccctcagaagcaaaagagtttgcctcgttcttaaatctcccctattct
tccaaactaactgtagaaactcaaaaaacaattttaaatctgtctcaccaaaccgcttca
atttttcatatcaacctactcaatgactacttggctctctgtccagagctaatctcaaag
cagctataccaagaaagaattaacgtcccaggaactctatcccatactaactggatatat
agagtacgcccatctatggaagagctttcctctcacgaacgttttaatcactatataaaa
gaaatacttccataa

DBGET integrated database retrieval system