KEGG   Chlamydia pecorum W73: CPE2_0271Help
Entry
CPE2_0271         CDS       T02855                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cper  Chlamydia pecorum W73
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cper00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPE2_0271 (glgB)
Enzymes [BR:cper01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CPE2_0271 (glgB)
Exosome [BR:cper04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPE2_0271 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277010..279172
Genome map
AA seq 720 aa AA seqDB search
MVDRLLDPWDLTLLVSGRQSNPHGILGIVPETPEQDRIILFRPGAEEVVVEFQGEIQYAH
PYHSGVFSLSVPKGVGLQDYRVYHQNGLLAHDPYAFPPVWGEIDSFLFHQGTHYRIYEKM
GAIPLEVAGVSGVLFVVWAPHAQRVSVVGDFNFWHGLVNPLRKLSKGIWELFIPGLDVGA
CYKWEIVTASGEILIKTDPYGKAFGTPPQGVAIVADPDRHVWRDQKWMLEREKVQERPMM
IYEMHVGSWQWHKDEHRPLGYRELAPKLVEYCKLMNFTFVELLPITEHPLNESWGYQVTG
FYAPTQRYGSLEDFQYFVDYLHNANIGVILDWVPGHFPTDSFALSSFDGEPLYECVRNPS
PLHPHWNTYTFDFFSKEVENFLLGSALFWCDKMHIDGLRVDAVASMLYLDYGRKEGEWLP
NVFGGKENLEVIEFFKHFNAILHEYFPGVLTFAEESTAFPNVTAPVCHGGLGFDYKWNLG
WMHDTFAYFTKDPIYRAYHQNLLTFSLWYAFHEKFLLPLSHDEVVHGKGSLFGKMPGDLW
SRFAQLRLLFSYQLCQPGKKLVFMGGEFGQMREWAPDCPLDWHLLELPEHKALQLCIAKL
NALYISSPGLWKKEDESSFRWVDFKDTSNNVISYFRFSDTPSQALLCVHHFSSGYFPSYV
ITCGRIESCSLLFNTDDEEYGGSGKGARPPILCRDSGEVWGIDIELPPLATVIFIVSFSV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcgtcttctagacccttgggatttaaccttgctcgtgtcgggaaggcaaagc
aatccccatgggattttagggatcgtccctgaaactcccgagcaggatcggattattctc
ttccgccctggggcggaagaggtagttgtggagtttcaaggggagatacagtacgcgcat
ccttatcattctggggtattttctctctctgtccctaagggggtaggacttcaagattac
cgcgtatatcatcaaaatgggcttcttgctcatgatccctatgcgtttcctcccgtgtgg
ggagagatagattcttttctctttcatcaggggacgcattatcgcatctatgagaagatg
ggcgcgattcctttagaggttgctggggtttctggggtgctgtttgttgtttgggctccc
catgcccagagggtctcggttgttggggactttaacttttggcatggtttagtcaatccc
cttaggaagctttcgaaagggatttgggagttgtttatccctggtctggatgtgggagca
tgttataagtgggagatcgttacagcatctggagagatccttatcaaaacagacccttat
gggaaggcttttggaacccctccccagggggtggctattgttgctgatcccgatcgccat
gtctggagggatcagaaatggatgcttgagagggagaaggtccaggagcgtcctatgatg
atttatgagatgcatgtaggatcttggcagtggcacaaggacgaacatcgacctttgggg
tatcgtgagcttgccccgaagcttgtggaatactgtaagcttatgaatttcactttcgtg
gagcttttgcctataacggaacatcccttaaatgaatcttggggttatcaagttacggga
ttttatgcccctacacagcgctatggctctctcgaggactttcagtattttgtagattat
ttacataatgcgaatattggtgttatcttagattgggttcctggacactttcctacagat
tcttttgcgctctcttcctttgatggagagcctttgtatgaatgtgttcgtaatccctct
cctcttcatccccattggaacacgtatacctttgatttcttttctaaggaggttgagaac
ttcctcctaggaagtgcgctcttttggtgtgacaagatgcatatcgatggcctgcgtgta
gatgctgtcgcttcgatgttgtatttagactatggtcgtaaagaaggagagtggcttccc
aatgtttttggggggaaggagaaccttgaggttatagagttctttaaacactttaatgca
atacttcacgagtatttccctggggtgcttacgtttgcagaggagtctacagcatttcct
aatgtgactgcacctgtatgccatggagggctaggatttgattacaaatggaacctcgga
tggatgcacgacacctttgcttatttcactaaggatcccatatatcgtgcgtatcatcag
aaccttcttacctttagcctttggtatgcgtttcatgagaagtttcttttgccgctatcc
cacgatgaggtagtccatgggaagggaagcctttttggaaaaatgcctggggatctatgg
tcacgctttgcccagctgcgcctgttgtttagctatcagttgtgtcagccggggaaaaag
ttggtctttatgggaggggaatttggccagatgcgcgagtgggcaccagattgtccttta
gattggcatcttttagaacttcccgagcataaagcgctgcagctttgcatcgcaaagctt
aatgctctttatatatcctcccctggcttatggaaaaaggaagatgagagttccttccgt
tgggtggattttaaagatacaagtaacaatgtgatctcctacttcagattttctgatact
ccctcgcaagcacttctttgcgtgcaccacttcagctcgggatatttcccttcctatgta
attacttgtgggagaatagagagctgctcactactttttaataccgacgatgaggaatat
ggcggctcaggaaaaggagcaagacctcccatactctgtagagattccggagaagtttgg
ggaatagacatagaacttcctcctttagcaacagtgatatttattgtgagtttttctgtt
taa

DBGET integrated database retrieval system