KEGG   Chlamydia pecorum W73: CPE2_0672Help
Entry
CPE2_0672         CDS       T02855                                 

Gene name
kynU
Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
cper  Chlamydia pecorum W73
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cper00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(767235..768500)
Genome map
AA seq 421 aa AA seqDB search
MIEKLKQYHDEAISLDSLDPLQKFKECFTLPKDPGALYFCSNSLGLPAKAASQKLEEQLQ
RWSELGARGWFEGEGNWYNSLEEPIVRPLSKILGAESNEVTLMNSLTVNLHMLLISFYRP
TKTRYKILIDGPAFPSDLYAIKSHLRFHKKEEGLILIEPRPGEHLVREEDFLRVIKKQGE
EIALVFLNCVNFLSGQVLKVDEITRYAKEAGCCVGYDLAHAAGNIPLSLHDLGGDFAVGC
SYKYLCGGPGGPGIAYVHASHHHQQFVRFSGWWGNDPNTRFYFPKEFVPYGGASSWQVST
PSILAKLPLIAALEVFEEAGMENIREKSKKQTAFLYTLLENARGTHFDMITPKEPELRGC
QLSLRIKCSHSEEILRKLERLGITCDFRPPNILRVAPSPLYTSFYEIYRFAYTFLEVLKT
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaagcttaaacaatatcatgatgaggctatctctctagatagcctggatccc
ttacagaaatttaaagagtgttttactcttcctaaagatcctggcgcactgtatttctgt
agtaactctctaggccttcctgcaaaagcagcttctcagaagttagaagagcagctacag
cgttggtcagagcttggagctagaggatggtttgaaggggaagggaattggtataactct
ctagaggaacctatagtaaggcctctctcaaagatcctaggtgcagagtctaacgaagtt
accttgatgaatagtctgacggtaaatttacatatgcttttaatttcgttttatcggcct
acaaagacgaggtataaaatcctaatagatgggccagcgtttccctcagatctttatgca
atcaagagtcatcttcgcttccataagaaagaagaaggattaattcttatagagcctcga
cctggagaacatctagtgcgggaggaggatttcctgagagtgattaaaaaacagggagag
gaaattgcgcttgtatttttaaattgcgtaaattttttatcagggcaagttctgaaagtt
gatgagattacgcgatatgcaaaggaagcaggctgctgcgtgggttatgatcttgcccat
gctgctggaaatattccactaagtctccatgatttaggaggagattttgctgtaggctgc
tcttacaaatacctatgtggagggccaggagggccaggaattgcctatgtgcatgcttcg
catcaccatcagcaatttgtacgttttagcggatggtgggggaatgatcctaacacgcga
ttttattttccaaaagagtttgtcccttatggaggggcttccagctggcaagttagtaca
ccatcgattcttgcaaagctacctttgattgctgctttggaggtatttgaagaggctggg
atggaaaatataagagaaaaatcaaagaaacaaacggcatttttatatacgttactagaa
aatgccagagggacgcattttgatatgattaccccaaaagaaccagaactcagaggatgt
caactctctttacgaataaaatgtagccatagcgaggagatcttaaggaaattagagaga
ttggggatcacttgtgattttagacctccaaatattttgagggtcgcaccatctcctcta
tacacctccttttatgaaatctatcggtttgcttacacatttttggaggtcttaaaaacc
atatga

DBGET integrated database retrieval system