KEGG   Clostridium perfringens ATCC 13124: CPF_0054Help
Entry
CPF_0054          CDS       T00378                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPF_0054 (recR)
DNA repair and recombination proteins [BR:cpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CPF_0054 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59974..60570
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSV
CGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMQGRGP
QDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPLDVKVTRIAAGIPVGGDL
EYADEVTLSKALEGRTVI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatccagtagctatagaaaagttaattgaagagtttgctaaattacctagt
ataggaaaaaaatcagctcaaagattaactttacatattttaaatttgccaaaggatgag
gtagaggaatttgcaaatgccttagtaaaagcaagaggaactattaaatattgttctgta
tgtggtaattttacagatacagatccatgtgcaatatgttcaaatcctaatagagaaaaa
gatataatatgtgtggttgaacaacctaaggatattatgacaatggaaaaagttaaagaa
tttaatggtttatatcatgttttacatggaactatttctccaatgcaaggaagaggacca
caggatataagaataagagaattagtagcaagaatgagcggagatgtaaaagaggttatt
gtagctacaaaccctactattgaaggggaagctacagctatgtatatttcaaagatatta
aagccattagatgttaaggttactagaattgcagcaggaatcccagttgggggagattta
gagtatgcagatgaagtaactttatctaaagccttagaaggtagaactgttatataa

DBGET integrated database retrieval system