KEGG   Clostridium perfringens ATCC 13124: CPF_0076Help
Entry
CPF_0076          CDS       T00378                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPF_0076
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPF_0076
   00052 Galactose metabolism
    CPF_0076
   00500 Starch and sucrose metabolism
    CPF_0076
   00520 Amino sugar and nucleotide sugar metabolism
    CPF_0076
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPF_0076
   00524 Butirosin and neomycin biosynthesis
    CPF_0076
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CPF_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
90897..91844
Genome map
AA seq 315 aa AA seqDB search
MKNYVVGIDLGGTKISCALADLEGNVKAQHTTPTNAHEGEQAVLDRIIGCVETVICEGKV
TIDEVEAIGIGSPGPLDARTGIIITTPNLPFKNFNLVSPLKAKFGIPVYLDNDANVAAIG
EFMLGAGKGTENMIYITVSTGVGGGAILNGKIYRGSTSNALEIGHSTVAPGTVRCNCGNM
GCLEAVSSGTAIGKRGREAVATNVETSLKDYDNVTSYEVFVEAAKGDRVAKSIIDEALNY
LGIGVANAIATFDPDMVVIGGGVSKAGEVVFETVQEVVNERCFKAMAEHCKIVPAGLGTD
AGVIGAVALALLECK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattacgttgttggaatagatctagggggaacaaaaattagctgtgctcttgct
gatctagaaggaaatgttaaagctcaacatacaactccaactaatgctcatgaaggagag
caagcagttttagatagaattataggctgtgttgaaactgtaatatgtgaaggaaaagta
actattgatgaagtagaagcaataggtattggatcaccaggaccactagatgctagaact
ggtataataataacaactccaaatttacctttcaaaaacttcaacttagtttcaccatta
aaagctaagtttggtattcctgtttacttagataatgatgctaacgtagctgctataggt
gaatttatgttaggtgctggaaaaggtactgaaaatatgatttatataactgtaagtact
ggtgtaggtggaggagcaatccttaacggtaaaatttacagaggaagtacttcaaacgca
ttagaaattggacattcaactgttgcacctggaactgtaagatgtaattgtggtaacatg
ggatgtctagaagctgtatcatcaggaacagctattggtaaaagaggaagagaggcagtt
gctacaaatgtagaaacaagcttaaaagattacgacaatgtaacttcatatgaagtattt
gttgaagcagctaaaggtgatagagttgcaaaatcaataatagatgaagctttaaactac
ttaggaattggtgttgcaaatgcaatagcaacttttgacccagacatggttgttataggt
ggaggagtttcaaaagctggagaagttgtttttgaaacagttcaagaagttgttaatgaa
agatgttttaaagctatggctgagcattgtaaaatagttcctgctggattaggaactgat
gcaggagttattggagcagtagctttagcattattagagtgcaaataa

DBGET integrated database retrieval system