KEGG   Clostridium perfringens ATCC 13124: CPF_0259Help
Entry
CPF_0259          CDS       T00378                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPF_0259
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CPF_0259
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPF_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
307745..310282
Genome map
AA seq 845 aa AA seqDB search
MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLEEKLGQMIMPDFRMWQ
EEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTTLIHDLQEVAINDEDGN
LPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGYVIGKELNALGVNVDFAP
VLDTNNNPENPVIGVRSISSNPELVGKLGKNIAKGIQDQGVAATAKHFPGHGDTATDSHY
GLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQIEKDTFISKKDGSQISIPAT
LSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELESTKMAINAGIDIILMPTILRNN
EDVKKLDYIVNGILDSIKSGEIKEEEITDSAERIVKLKIDRGIIDLKNNNASLEEKIKKA
KKTVGSVENRNIERRISEEAITITKNEENILPLNPKEGEKVLLIAPNESQIHSMKFGINR
LIHENSLNNIKLDTYEYNNIGIIDDVLKEKIESSDYIIVASLSSNANHLKPGAWNRDLPR
SVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNI
PASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKI
NLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVL
INLEEGSLKANEVNFILEFKAIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNK
EDKPLSPDEDKEDEENNEDLGNSDDNNKDELPQTGSGVGKEFIFGLGSLSLLAGIGLKSK
RFKRK
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaagaaattagctgcaatattaactgtagcctcaataggtgctactattttt
actagtaataaagaggttatggcaactgactcttatagtaaggcaaaagaaatagtttct
aacatgactttagaagaaaagcttggtcaaatgataatgcctgattttagaatgtggcag
gaagaaggagctaaagaaccaagtgatttaacagaaataaatagtgaagttgcagaggtc
atagataaatatgatttaggtggagttatactttttgctgaaaatgttaaggagatatct
cagacaactactttaatacatgatttacaagaggtagctataaatgatgaagatggaaat
ttaccattacttataactttagatcaggagggtggaatagtaactaggcttggagaagga
actaacttacctggtaatatggcattaggtgccactagaagtgaaaagtcttcatatgat
gctggttacgtaataggaaaagaattaaatgctttaggagtaaatgtagactttgctcca
gttctagatacaaataataatccggaaaatcctgttataggagtaagatcaatttctagt
aatccagaacttgtagggaagttaggaaaaaatattgctaagggtattcaggatcaagga
gttgctgctactgcaaaacattttccaggtcatggtgatactgcaacggattcacattat
ggtttgccaatggtagataaatctattgaagaactcagggaaacagaacttaaaccattt
aaaatagctatagaaaatggtatagatatgataatgacagctcatatacaatttcctcaa
atagagaaagatacttttatatcaaaaaaagatggaagccaaatatcaattccagccaca
ttatcagatgatattataaaaggaattttaagagaagaaatggagtatgatggtgttgta
ataactgatgcaatgaatatgaaagctatatcagatcattttggagaattagagtcaaca
aaaatggctataaatgcagggatagatattattcttatgcctactatattaagaaataat
gaggatgttaaaaaattagattatatagtaaatgggattttagactctattaaaagtgga
gaaataaaagaagaggaaataactgattcggctgaaagaatcgttaaactaaaaatagat
agaggaataattgatttaaaaaataataatgcatctttagaggaaaagattaagaaagct
aagaaaactgttggatctgtagaaaatagaaatatagaaagaaggatttcagaggaagca
attactattactaaaaatgaggagaatatacttccactaaatcctaaagaaggagaaaaa
gttttactaatagcgccaaatgaaagtcaaattcatagtatgaagtttggtataaataga
cttatacatgaaaatagtttaaataatattaagttagacacctatgagtacaataacata
ggaataattgatgatgtattaaaagaaaaaatagaaagttctgattatataatagtggct
tctctgtcaagtaatgctaaccacttaaagcctggggcttggaatagagatttacctagg
tcagtaattgattatggaaataagttgaataaagatactgtattaataagtttaagaaat
ccatatgatttggcagcttatgataacgctaaggcacaggtagttgcatatggatttaaa
ggaatggatccaacagaaggagatactttgtttccaactaaatcttcaggacctaatata
ccagcatctatgggagttgtttttggagctgtagagcctaagggaaagttaccagtagat
attccaagtttaaataatgatggaactatgaatactgaagttaattattacgattatgga
catggcattacaaacatcaatagcttgggaaatgttaacattagtatgaataaaaaaata
aatttaggtgataattttcaagtaaagtttaatttaagtgattttaatgaaatagtagca
ggtaaatatagagccaagattaaatttcaaggagaaaaattagaatttattaatggtaag
gtagagtttagtggagatttacaaactaatattatagataataatactttagaagtttta
ataaatttagaagagggttctcttaaggctaatgaagttaatttcattttagaatttaag
gcaattgataaagctgaattaactagcatagaaataacaagttcagaacttattgatgaa
aaaggaagatgttttaaacagaaatatgttatttcagaattttcgatagaagataataaa
gaggataagcctctaagcccagatgaggataaagaagatgaagaaaataatgaggattta
ggtaatagtgatgataataataaagatgaattaccacaaacaggttcaggtgttggtaaa
gaattcatttttggattagggtctctatcacttttagctggaattggattaaaaagcaaa
agatttaaaagaaaatag

DBGET integrated database retrieval system