KEGG   Clostridium perfringens ATCC 13124: CPF_0362Help
Entry
CPF_0362          CDS       T00378                                 

Definition
type III restriction-modification system, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cpf  Clostridium perfringens ATCC 13124
Brite
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CPF_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434536..437700
Genome map
AA seq 1054 aa AA seqDB search
MSKSVKFKFEKNLPHQDKAIDSVVSLFSDVDKSIDNSVYSGTINAIREKLQGEIVDRRNN
QISNGKKLRDNLRKIQSNNGLILNDEVETDNNTLTFTIEMETGTGKTYVYLKTILELYKK
YDGKFKKFIIVVPTVPIRMGVEKSIEMLNEHFSEQFDGLDISKHVFIYNSKLKDVAESVR
RKFIDSQDLSILVMNTQAFNKDTNILRNTDHEKNTENISVWDEIRQLHPVVIIDEPQKFD
GGKNSKKRTSSLSAIDEIQPTFTLRYSATHNEIINPTYKLDSYAAYRDKLVKRIKVKTVN
KLVPTDFPYIRYLEFTKDLYAKIEIFYAEQGKEITKKTFKVRQDSNGNIFELSGDLPQYR
NFRIAENPFKGKSLKIETSDRLVEINEGDCLSPFSEKENVRIQMKIAIQSHLEQQFNLLE
SGQKIKALSLFFIDRVSKVRGEDGEDGEYLKIFDSVYNEVISDPTYNKIFEKYPDYFKEY
KDTKKVRQGYFAIDKKKGSTIVKEIEGWNEDGNDSSISLKAKDKEYIERGIELILEKKDG
LISFEEPLAFIFSHSALREGWDNPNVFTLCTLKNSSNSIAKKQEIGRGLRLPVDTEGNRC
KDESLNVLTVVANDSYDHFSEKLQQSYDEESGFNKDEVTNDVINIVFKKAGIPIEKITSE
LTTAFRNELRENGLIDKNDILKKDAEEKFSEIQFKNETLKEHSANIRKEFVNQMKSKGSK
KINIENGDLTPVKNKMQSYVKEADFKRLLKGINERLAQKTIYKININKDNFIEDCIKEIN
NTLHCKEISNIVEHSEGMHYIDENNKAKFEKSTEFITEEVVENIQVKSDFEIINYIMVGT
ELPRMTISKILKEIKNRKILNSQDYLDDVMMIIKEIFIRHQVKDKISYELLNGYKFDSKT
IFSIDEINATELNDPKIITYKANSLKRKAINEYYKFDNEKELEFAQSLENDPNILLFTKI
KKGGFVILTPYGNYSPDWAVVYKNNYGKAEIYFIVETKFDKKEADLSEVEKFKIHCGKEH
FKVVSKNSEDYVKFDWANSYEQFKEESSKVKVMQ
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagtgttaagtttaagtttgaaaagaatttgcctcatcaagataaagcaatt
gattcagtagtttctctttttagtgatgttgataaaagtatagataattctgtttattct
ggaactataaatgcaattagagaaaagttgcaaggagaaattgttgatagaagaaataat
caaatttctaatgggaaaaagttaagagataatctaagaaagattcaatctaataatgga
ttaatcttaaatgatgaggtagaaacagataataatacattaaccttcaccatagaaatg
gaaacaggtacaggaaaaacctatgtttatttaaagactattttagagttatataagaag
tatgatggaaagtttaaaaagtttattatagtagttcctactgttcctattagaatggga
gtagaaaagagtatagaaatgcttaatgaacatttttcagaacaatttgatggacttgat
atatcaaaacatgttttcatttataattctaaacttaaagatgttgcagaaagtgttaga
aggaaatttattgatagtcaggatttaagtattttagttatgaatactcaagcttttaat
aaggatactaatattcttagaaatacagatcatgagaaaaatactgaaaatataagtgtt
tgggatgaaataagacaacttcatccagttgttataattgatgaaccacaaaaatttgat
gggggtaagaatagtaagaaaagaacatcttctttatcagctatagatgagattcaacct
acatttacactaagatattcagctactcataatgagattataaatcccacttataaattg
gattcatatgctgcatatagagacaagcttgttaaaagaataaaagttaaaactgttaat
aaacttgttccaacagattttccttatataagatatttagaatttaccaaggatttatat
gcaaaaattgaaattttttatgctgagcagggaaaagaaattactaagaaaacttttaag
gttagacaagatagtaatggaaatatatttgagttatcaggagatttacctcaatataga
aattttagaatagctgagaatccttttaaaggaaagagtttaaaaatagaaacttcagat
agactggttgaaataaatgaaggggattgtttaagtccattttcagaaaaggaaaatgta
agaattcaaatgaaaatagccatacaatctcatttagaacaacaatttaatcttcttgaa
agtgggcagaaaataaaagctttaagtttattctttatagatagggtaagtaaggtaaga
ggagaagatggagaggatggagaatatttaaaaatatttgattcagtttataatgaagta
atttctgaccctacttacaataagatttttgaaaagtatccagattattttaaagaatat
aaggacactaagaaagtaagacaaggatattttgctattgataagaaaaaaggaagtaca
atagttaaagaaattgagggatggaatgaggatggaaatgattcttcaatttctttaaaa
gctaaggataaagaatatattgaaagaggtattgaattgattttagagaaaaaggatgga
ttaatttcttttgaagagcctcttgcatttatattttctcactcagcacttagagagggg
tgggataatcctaatgtatttactctttgtaccctaaaaaatagtagcaattcaatagct
aagaagcaagaaataggaaggggattaagacttcctgttgatacagaggggaatagatgc
aaggatgaaagtttaaatgttctaactgtggtggctaatgatagttatgatcactttagt
gaaaaacttcaacaaagctatgatgaagaatcaggatttaacaaggatgaagtaactaat
gatgttataaatatagtattcaaaaaagcagggattccaatagaaaaaataacatcagaa
ttaacaactgcttttagaaatgaattaagagaaaatggacttatagataaaaatgatatt
cttaaaaaggatgctgaagaaaagtttagtgaaattcagtttaaaaatgaaactttaaaa
gaacactcagctaatattagaaaagaatttgtaaaccaaatgaaaagcaaaggctctaag
aaaattaatattgaaaatggtgatttaacccctgttaaaaataaaatgcaatcatatgtt
aaggaagctgattttaaaaggctattaaaaggaattaatgaaagattagctcaaaaaact
atatataaaattaatattaataaagataatttcatagaagattgcattaaagaaataaat
aatactcttcattgtaaggaaataagcaatatagttgagcatagtgaaggtatgcattat
attgatgaaaataataaagctaaatttgaaaagtctactgaatttataacagaagaagta
gttgaaaatatccaagttaaaagtgattttgaaatcataaattatataatggttggtaca
gaattgccgagaatgactataagtaaaatattaaaagaaattaaaaatagaaaaatatta
aatagtcaagattatttagatgatgtaatgatgataataaaagaaatattcataagacac
caagtaaaagataaaatatcttatgaacttttaaatgggtataagtttgatagtaagact
atattttcaatagatgagattaatgcaacagaattaaatgaccccaaaattataacttat
aaagcaaatagcttaaaaagaaaggctattaatgagtattataaatttgataatgaaaaa
gaattagaatttgcacaatccttagaaaatgatcctaatatattactctttactaagatt
aaaaagggagggtttgtaatattaactccttatggaaactattctccagactgggctgta
gtctacaaaaataattatggtaaagcagaaatttattttatagttgaaacaaaatttgat
aaaaaggaagcagatttatcggaagtagaaaaattcaaaatacattgtggaaaagagcat
tttaaagtagtatcaaaaaatagtgaagactatgttaagtttgattgggcaaattcatat
gaacaatttaaagaagaatcttcaaaggttaaagtaatgcagtag

DBGET integrated database retrieval system