KEGG   Clostridium perfringens ATCC 13124: CPF_0487Help
Entry
CPF_0487          CDS       T00378                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPF_0487 (galU)
   00052 Galactose metabolism
    CPF_0487 (galU)
   00500 Starch and sucrose metabolism
    CPF_0487 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CPF_0487 (galU)
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPF_0487 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
578221..579165
Genome map
AA seq 314 aa AA seqDB search
MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGR
SKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIYCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYRTSVLGVQTVPEENVSKYGIVNGKHI
EGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELM
SEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSATENIFTEANG
KEKKDKEEELVTEA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaataagaaaagctataataccagcagcaggtcttggtactagattttta
cctgcaacaaaggcacagcctaaggagatgcttccaatagttgataagccaactattcaa
tacataattgaggaagctatagcttcaggtatagaggaaatacttgttattacaggaaga
agtaaaaaatcaattgaggatcactttgaccgtaatgttgaacttgaaatggaacttgaa
aagtcagggaaaactgaacttttagatttagttagagatatatcagatatggttgatatc
cattatataagacaaaaagaaccaagaggacttggacatgctatctattgtgctaagact
ttcgtaggggatgagccttttgccatattacttggtgatgatgtagtttataatgaagaa
aagccatgcttaaagcaattaattgattgttataacgaatatagaactagtgtattaggt
gttcaaactgttccagaagaaaatgtttctaaatacggaatagttaatggaaaacacatt
gaaggtagagtttataaagtaaaaggcttagttgaaaagccatcaccagaagaagcacct
tcaaatgttgctatattaggaagatatatagtaactccaagaatatttgatatattagaa
aacacaaaacctggtaaaggtggagaaatccaattaacagatgcacttttagagcttatg
agcgaagaagctatgtatgcttatgactttgaaggaagaagatatgatgtgggagataaa
cttggattcttagaagcaactgttgagtatgctttaagaagaccagatcttagagatggg
tttattgattacttaagagaattatctgctacagaaaatatctttactgaagcaaatggt
aaagaaaaaaaggataaagaagaagagcttgtaacagaagcttaa

DBGET integrated database retrieval system