KEGG   Clostridium perfringens ATCC 13124: CPF_0491Help
Entry
CPF_0491          CDS       T00378                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPF_0491
  Lipid metabolism
   00561 Glycerolipid metabolism
    CPF_0491
   00600 Sphingolipid metabolism
    CPF_0491
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CPF_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
585866..588070
Genome map
AA seq 734 aa AA seqDB search
MRIMSINYNENFKTFHLRTKNTSYVLKVMETGHLSHLYWGRKLKADNLEYFVRRRGFGSF
AADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSATDLRYKSHRIYEGKQRLS
GLPAVYVESEEEATSLEITLVDSLKNLEVILTYNVFENFDSITRSLKIVNNSDEKINIER
VLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQAIESRRGASSHAQNPFMALCSK
DANEEYGDVYGFNLVYSGNFLANVEVDMYRNARAQIGINPFDFKWLLESKEEFQAPEVVL
VYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPVLINNWEATYFDFNEVKIKEIAKEASK
LGMELFVLDDGWFGNRNDDKSSLGDWFVNEEKLKGGLSKLAKDINNMGLEFGLWFEPEMI
SPISKLYEKHPNWCIHIPGRTRSQARSQLILDLSMKEVCDYIIESVSKILESSNISYVKW
DMNRNMTEVGSLGLTSERQRETAHRYILGLYRVMEEITSRFPNVLFESCSGGGGRFDPGI
LYYMPQTWTSDDTDAIERLKIQFGTSMIYPPISMGCHVSAIPNHQANRTTPLETRGVSAM
AGNFGYELDITKLSEEEKEELKEQISLYKEIRETVQFGALYRLKSPFNSNEVAWMMISED
KNEVVVSYVRQWALVNESFSNLKLTALDKDSEYEIIGEDTILSGDELMYIGLNIPELYGD
YVSKLWRLKRKTLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagaattatgagtataaattataatgagaattttaaaacttttcatctaaggacaaag
aatacaagttatgttttgaaggttatggagacaggacatttaagtcatttgtattgggga
agaaagttaaaagctgataacttagagtattttgttagaagaagaggttttggaagcttt
gcagctgatactgataatataagtggatttcagttagagttaatacctcaagagtgtcca
acctttggagctactgatttaagaagtccaagcttagagtttcaatatgaagatggtaca
tcagctactgatttaagatataagtcacatagaatttacgaaggaaagcaaagactttca
ggtttaccagctgtgtatgttgaaagtgaggaagaggctacttccctagaaataacttta
gttgattctttaaaaaacttagaggttatcttaacatataatgtttttgaaaactttgat
tctattacaagaagtttaaagatagtgaataatagtgatgaaaagataaatatagagaga
gttttaagtgccaatgtagactttacaactgatgaatttgattttattcagctttcagga
tcttggggaagagagagacatattcttagaaatcctttaagaagtggaagccaagctatt
gaaagtagaagaggggcaagtagccatgctcaaaatcctttcatggctctatgtagtaag
gatgccaatgaagaatatggagatgtttatggctttaacttagtttatagtggaaacttc
ttagcaaatgtggaagttgatatgtatagaaatgcaagagctcaaataggaataaatcct
ttcgattttaaatggttacttgagtcaaaagaagagtttcaagcaccagaggtagtttta
gtttattcctcaaagggactaaatggcatgtctcaaatttatcataatctttatagaaag
agattgtgtagaggaaattatagagataaggtaagacctgtgcttataaataactgggaa
gccacatattttgactttaatgaggttaagataaaggaaatagctaaggaagcttcaaag
ctaggaatggaactttttgttcttgatgatggatggtttggaaatagaaatgatgataaa
agttccttaggagattggtttgttaatgaggaaaaattaaagggtggacttagtaaactt
gctaaagatataaataatatggggttagagtttggattatggtttgagcctgagatgatt
tcacctattagtaaactttatgaaaaacatccaaattggtgtattcatattccaggaaga
actagatcacaggcaagaagtcagttaatattagacctatcaatgaaagaagtatgtgat
tatataatagaatctgttagcaaaattcttgaaagttctaatatatcttatgttaagtgg
gatatgaatagaaatatgacagaggtgggttctttaggattaacttcagagagacaaaga
gaaacagctcatagatatattttgggattatatagggttatggaggaaataacaagtaga
ttccctaatgtattatttgaaagctgctcaggtggtggtggaagatttgacccaggaata
ctttattatatgcctcaaacttggacaagcgatgatacagatgccatagaaagattaaaa
atacagtttggaacctctatgatttatcctccaatttccatgggatgccatgtttcagca
attcctaatcatcaagctaatagaacaactccacttgaaactagaggggtatctgctatg
gcaggtaattttggatatgagcttgatataactaagttaagtgaggaagaaaaggaagaa
ttaaaggaacaaataagtttatataaagaaattagagaaactgtgcaatttggagctttg
tatagattaaagagtccatttaatagtaatgaagttgcatggatgatgatttcagaagat
aagaatgaggttgttgtaagctatgttagacagtgggctttagtaaatgaaagctttagc
aatttaaaacttacagccttagataaggattcagagtatgaaataataggagaagacaca
atccttagtggagatgagcttatgtatataggtttaaatattccagaactttatggagat
tatgtttcaaaactttggagattaaagagaaaaactttaaaataa

DBGET integrated database retrieval system