KEGG   Clostridium perfringens ATCC 13124: CPF_0530Help
Entry
CPF_0530          CDS       T00378                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cpf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
627528..628385
Genome map
AA seq 285 aa AA seqDB search
MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQVMRGESWGLESYSPYQ
DLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKIPAMIGGEHLVTLGAFKGV
FKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLVGDNKIFQFGIRSGEKEEFLW
AKDHVYTNKFNCDTLDYALEMVKDKPVYVTIDLDVLDPSVFPGTGTPEPGGIQFNELLNS
ILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLREMLLVANNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaatagaaatgtaagcacttttatagggtgtgaagctgaatatgatgaatca
agcatagttgtatttggagctccttttgattcaacaacttcttttagaccaggtactagg
tttgcaagccaagtgatgagaggagaatcttggggattagaaagctatagtccatatcaa
gatttagatctttatgattttaatattttcgatggaggagaaatagagcttcctttcgga
aattcagagggagcattagctttaatagaggatttttcaactaaggttgttgaagatggg
aaaataccagctatgataggtggagagcatttagtaactttaggggcatttaaaggagta
tttaaaaaatatcctgatgttcatgtaattcactttgatgctcatgcagatttaagagaa
gattatttaggtcaaaaactatctcatgctactgttatacatagagtttgggatttagta
ggagataataaaatattccaatttggaatacgttctggtgaaaaagaagaatttttatgg
gcaaaggatcacgtttatacaaataagtttaattgtgatactttagattatgccttagaa
atggttaaagataaacctgtttatgtaacaatagacttagatgttttagacccatctgta
ttcccaggtacaggaacaccagaaccaggtggaattcagtttaatgagcttctaaattca
atattaaaacttagagggttaaatattgtgggatttgatattaatgaattatcaccacag
tatgaccaaacaggagcatcaacggctgtggcttgtaaagttttaagagagatgttatta
gtagcaaataacaaataa

DBGET integrated database retrieval system