KEGG   Clostridium perfringens ATCC 13124: CPF_0766Help
Entry
CPF_0766          CDS       T00378                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPF_0766
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPF_0766
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPF_0766
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CPF_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
908589..911627
Genome map
AA seq 1012 aa AA seqDB search
MILKNEYHEDISKLHVNMMPRRSYYVPFVDTDEALNIKDRSKQLNFFSLNGKWEFNYFDS
LQKVKEFDDINQISFSDNIDVPSLWQLKGYDYNQYTNVKYPIPFDPPFVPINNPCGIYKR
DFEIEILPENYDYNINFEGVDSCFYFWINDNFVGYSQISHSISEFDITEFLVKGKNTITV
LVLKWCDGTYFEDQDKFRMSGIFRDVYILRRAKERIVDYKITQSIDFSAKEGKLDLEILS
NIGNPKGKYYLLNPNNHMIASGNIDNNKIQINIKNVELWSAEIPNLYTLLIETEHEVIKE
RIGMREIKIENSILKINNKKIKLRGVNHHDSNPTKGYVMTYDDMILDLKIMKECNVNSIR
TAHYPKSPIFYELCDEYGFYVMSEADIEIHGVVELYGLGYLDNYNMIADDKVYEKVIIDR
VDSSIVPFKNKSCIFMWSLGNESGFGCNFERGLEYARALDPTRPLHYEGAYYASKEREND
FTNIDVISRMYISIEEIKDYFEKGIDKPLILCEYAHAMGNGPGGLQDYDEMIQKYDQFAG
AYVWEWCDHAILINENINDKKAYGYGGDFEEENHDGNFCVDGLVYPDRTPHTGLLEYKNI
NRPIRAIEFDEVKKRVKLKNMFDFRNAGEFLDVTYKVFLDGEIIFGDDIDLESLKAKEEK
WYDLSISELPKEIITILFQYKVKNHNHLYEKGEVLGFDNFIIKNGVDNISSVDKIIKGNI
NEQKFYVEETVNKIKVINNEFIYNYNKNTGSFDFIQALGETFIDDPMKFIIWRAPTDNDR
KIKNLWIEAGFNQITTRVYNSKIKEFSNRVEITSDLSLIPPYRERVLDLKVTWSIYSEGL
IKCHVKGDKNMKTPYLPRFGVELKLNKSYEEVSYFGFGPYENYVDKNSSCYLGRFNSKVS
EMHEDYIRPQENGSHHYCREVAINNEKGKVYVLSENDFAFNVSHFSLNQLTNANHNFDLN
EEEATYLIVDYKQSGIGSNSCGPDLDEEYRLNEKEFSYDFYLKFVKDNIKDN
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaaaaatgaataccatgaagatatttctaaactgcatgtaaatatgatgcca
agaagaagttattatgttccttttgtggatactgatgaagctttaaatattaaagataga
agtaagcaacttaacttcttttcacttaatggtaaatgggaatttaattactttgatagc
ttacaaaaagttaaagagtttgatgatataaatcaaattagtttttcagataatattgat
gttccatctctttggcaattaaagggatatgattataatcaatacactaatgtaaaatat
ccaattccttttgatccaccttttgttcctataaacaatccatgtggaatttataagaga
gattttgaaattgaaatacttcctgaaaattatgattataatataaactttgaaggcgtt
gattcctgcttttatttttggataaatgataactttgttgggtatagccaaatatctcat
agcatatctgagtttgatattacagaatttttagtaaagggtaaaaatacaattacagtc
ttagttttaaaatggtgtgatggaacttattttgaagatcaagacaagtttagaatgtct
ggaatttttagagatgtatatatattaagaagagcaaaggaaagaatagttgactataaa
ataactcaaagtatagatttttcagctaaagaaggaaagttagaccttgaaattttatct
aatataggaaatccaaaagggaaatattatttgttaaatcctaataatcacatgatagca
tctggaaatatagataataataaaatccaaatcaatattaaaaatgtagaactttggagt
gctgaaatacctaatttatataccttattaattgaaacagagcatgaggttataaaagaa
agaataggtatgagagaaattaaaatagagaattctattttaaaaattaataataaaaaa
ataaagttaagaggagttaatcatcatgatagtaatccaactaagggatatgttatgaca
tatgatgatatgattctagatttaaaaataatgaaagagtgtaatgttaactctataaga
acagctcattatcctaaatctccgattttttatgagttatgtgatgaatatggtttttat
gttatgagtgaggcagatattgaaattcatggggttgttgaactatatggattaggatat
ttagataattataatatgatagctgatgataaagtttatgaaaaggttattattgataga
gttgattcatctatagttccttttaagaataaatcttgtattttcatgtggtctcttgga
aatgagtcaggatttggatgtaactttgaaagaggattagaatatgctagggcattagat
cctacacgtccacttcattatgaaggtgcttattatgctagcaaagaaagagaaaatgac
tttacaaatattgatgttattagtcgtatgtatataagtatagaggaaatcaaggattac
tttgaaaaaggaatagacaagccattaatattatgtgagtatgcacatgctatgggaaat
ggaccaggtggattacaagactatgatgaaatgatacaaaagtatgaccagtttgcaggg
gcatatgtttgggagtggtgtgaccatgcaatacttattaatgaaaatattaatgataaa
aaagcatatggatatggcggcgattttgaagaggaaaatcatgatggaaacttctgtgta
gatggtttagtttacccagatagaactcctcatactggattattagaatataaaaatatc
aatagacctataagagccatagaatttgatgaagttaagaaaagagttaagcttaaaaat
atgtttgattttaggaatgctggtgaattcttagatgttacctataaagtatttttagat
ggagaaataattttcggagatgatatagatttagaaagcttaaaagcaaaagaagaaaaa
tggtatgatttaagcatatcagaattaccaaaggaaattataactatattatttcagtat
aaagtgaaaaatcataatcatctgtatgaaaaaggtgaagttctaggctttgacaatttt
atcataaaaaatggggtagataatatctcatctgttgataaaatcataaaaggtaatatt
aatgaacaaaaattttatgtagaagaaacagttaataagattaaagttataaataatgag
tttatttataattataataaaaatacaggttcctttgattttattcaagcattaggagaa
acatttatagatgatccaatgaaatttattatttggagagcacctacagataatgataga
aagattaaaaatctgtggattgaagctggctttaatcaaattactacaagagtgtataat
agtaaaattaaggagttttcaaatagggtggagataactagcgatttaagcttgatacca
ccatatagagaaagagtccttgatcttaaggtaacatggagtatctattcagaggggtta
attaaatgccatgttaaaggggataaaaatatgaaaacaccttatttaccaaggtttggt
gtagagcttaagctgaataaatcctatgaagaggtaagttactttggatttggaccatat
gaaaattacgtagataaaaattcatcttgttatttaggaagatttaattctaaggtttct
gaaatgcatgaagattatataagacctcaagaaaatggaagtcatcattattgtagagaa
gtagctattaataatgaaaaaggaaaggtttatgttttatcagaaaatgactttgccttt
aatgtttcacacttttctttaaatcaattaactaatgcaaatcataattttgatttgaat
gaagaagaggcaacttatttaattgtagattataaacaaagtggtataggatcaaatagt
tgtggccctgatttagatgaagaatatagactaaatgaaaaagaattttcttatgatttc
tacttaaaatttgtaaaagataatataaaggataattaa

DBGET integrated database retrieval system