KEGG   Clostridium perfringens ATCC 13124: CPF_1274Help
Entry
CPF_1274          CDS       T00378                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00790  Folate biosynthesis
cpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPF_1274 (folE)
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CPF_1274 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF FolB
Motif
Other DBs
NCBI-ProteinID: ABG84686
UniProt: Q0TRM0
Position
1449301..1449858
Genome map
AA seq 185 aa AA seqDB search
MIDKDKIREGMKLILEAIGEDINREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEVH
SNDLVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERL
TTEIADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF
RMISM
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataaagataagataagagaaggaatgaaactaatacttgaagcaataggagaa
gatattaatagagagggcttaatagaaactccagatagaattgcaagaatgtatgaagaa
atattttcaggaataggaatgaatgcaaaggagcatttaagtaaaacttttgaagttcat
agcaatgatcttgttttagagaaggatataactttctattctatgtgtgagcatcattta
gttcctttctatgggaaagttcatatagcatatataccaaatggaagggttgtaggttta
tctaaacttgctagatgtgttgaggtttattcaaaaaaaccacaacttcaagaaaggctt
acaacggaaatagctgattctataatggaatacttagatgcacaaggtgtaatggtagtt
gtagaaggtgaacatatgtgtatgaccatgagaggtgttagaaaaccaggtgcaaaaaca
gtaacaacaacttatagaggaaagttcttagaagatgaaagcttaaaaaatgatgttttt
agaatgatttctatgtag

DBGET integrated database retrieval system