KEGG   Clostridium perfringens ATCC 13124: CPF_1389Help
Entry
CPF_1389          CDS       T00378                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPF_1389
   01230 Biosynthesis of amino acids
    CPF_1389
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPF_1389
   00030 Pentose phosphate pathway
    CPF_1389
   00051 Fructose and mannose metabolism
    CPF_1389
   00052 Galactose metabolism
    CPF_1389
  Energy metabolism
   00680 Methane metabolism
    CPF_1389
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPF_1389
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPF_1389
Protein phosphatases and associated proteins [BR:cpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPF_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562304..1563401)
Genome map
AA seq 365 aa AA seqDB search
MQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYNNDFVKLDLDS
VSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGVENLKKEEVDALVVIGGDG
TLTSARDFARKGVNVIGVPKTIDNDLLATDVTFGFNTATEIATEALDRLHTTAESHHRIM
LLEVMGRNAGWIALESGIAGSADVILLPEIPYDINKIVEKVKEREEAGKQFTIIVVAEGA
KPKDGEVVVSKIVDDSPDPIRLGGIANKLAIDLEGLIKNHEIRSTVLGHIQRGGNTSTYD
RILSTKYGVKAVELINSNLFGNMVALKGNKVSYESLENVIGHTKNVDPEGELVNTAKSIG
ISFAD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattaagaaaatagctatactaacaggaggaggagattgtcctggattaaat
gcagtaataagagctgtaactagaactgcaatcttaaaatatggatatgaagttataggt
tataaatttggatatagaggtctatataataatgactttgtaaaattggatcttgattct
gtttctggaatacttcatagaggaggaacaatacttcatagttcaaataaggacaaccta
tttgattatcaagttgaagatgagaatggtaaaatagttaaaaaagatgtttctgatgtt
ggtgttgaaaacttaaagaaagaagaggtagatgctctagttgttattggaggagatgga
accttaacctctgcaagagatttcgcaagaaaaggtgttaatgtaataggtgttcctaaa
acaatagataacgatttattagccacagatgtaacctttggatttaatactgccacagaa
atagctacagaagctttagatagacttcatactacagctgagtcacatcatagaataatg
cttttagaagttatgggaagaaacgctggttggattgctttagaatcaggaatagctggt
tctgctgatgtaatattattacctgaaataccttacgatataaacaagatagttgaaaaa
gtaaaagaaagagaagaagccggaaaacagtttacaattattgtagttgcagaaggagca
aaacctaaagatggagaagtagttgtttctaaaatagttgatgatagtccagacccaata
agattagggggaatagctaacaaattagctattgacttagaaggattaataaaaaatcat
gaaataagaagcactgttcttggacatatacaaagagggggaaatacctctacttatgat
agaatactttccactaaatatggagttaaagctgttgaacttataaatagtaatttattt
ggaaacatggttgcattaaaaggaaataaagtatcctatgaaagcttagaaaatgtaatt
ggacatactaaaaatgtagatccagaaggtgaattagtaaacactgctaaaagtatagga
attagtttcgctgattaa

DBGET integrated database retrieval system