KEGG   Clostridium perfringens ATCC 13124: CPF_1421Help
Entry
CPF_1421          CDS       T00378                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPF_1421
  Amino acid metabolism
   00300 Lysine biosynthesis
    CPF_1421
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CPF_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(1602430..1603827)
Genome map
AA seq 465 aa AA seqDB search
MNLISSKIDEMKDDLIESVQNIIRIKSVEDEPKEGMPFGEGVSKSLECALEISKKLGFKV
VNLDGHVGYAEYGDGEEYVAALGHLDVVPEGDDWIYPAYGAEIHDGKIYGRGTTDDKGPI
MASLYGLKAIKELGLPLSKKIRIIFGTNEETGSKDIEYYLEHEKAPVAGFTPDAEFPIIN
GEKGITIFDIVKTFGEKTTDGDVLVESIKGGIASNVVASLCETKLKAKEANKVCEEISKF
AKENNIKFEVSHKNDEIELKVFGVSAHGSTPEKGINAIMQTIKILAELNLAQEDIKAFVK
FLNDNIGEDVYGEKFGILLQDEASGKLSFNVGVIDLNDKVGRLTLNLRYPVTKTLDDMMT
PFNERIKGTGIEIENFEHQKPLYFSPDHPLIKTLKNVYKEETGKEGELMSIGGGTYAKEM
PNIVAFGPIFPGEPDVIHKPNEYIKIDDLILISKIYAKALYELAK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaataagtagcaaaattgatgaaatgaaagatgatttaattgagtcagtacaa
aatattattagaatcaaaagtgttgaggatgaaccaaaagagggtatgccttttggggaa
ggagtttctaaatctttagaatgcgccttagaaatttcaaaaaaattagggtttaaagta
gttaatttagatggacatgtaggatatgctgaatatggtgatggagaagagtatgtagca
gctttaggacacttagacgttgttccagaaggtgatgattggatttacccagcatatggt
gcagaaatacatgatggaaaaatatatggaagaggtacaactgatgacaaaggtccaata
atggcatcattatatggattaaaagctataaaagaattaggattacctttatcaaagaaa
ataagaataatatttggtactaatgaagagactggaagcaaggatatagaatactattta
gaacatgaaaaggctccagtagcaggatttactcctgacgcagaattccctataataaat
ggagaaaagggtatcactatttttgacattgttaaaacttttggagaaaaaacaactgat
ggagatgtattagttgagagtataaagggtggaatagcatcaaatgtagttgctagtctt
tgtgaaacaaaattaaaagctaaggaagcaaataaggtttgtgaagaaatatcaaaattt
gctaaagaaaataatataaaatttgaagtatcacataaaaatgatgaaatagagttaaaa
gtatttggtgtctcagctcatggtagtactccagaaaagggtataaacgctataatgcaa
actattaaaattttagcagaattaaatttagcacaagaagatataaaagctttcgttaaa
ttcttaaatgataacataggtgaagatgtctatggagaaaaatttggaatcttattacaa
gatgaagcatcaggaaaattaagctttaatgttggagtgattgatttaaatgataaagta
ggaagacttactttaaacttaagatatcctgtaactaagactttagatgatatgatgact
ccttttaatgaaagaataaaaggtactggcatagaaatagaaaactttgaacatcaaaaa
ccattatatttctctccagatcatcctttaataaagactttaaagaatgtatataaagag
gaaactggaaaagaaggagaattaatgtctattggaggaggtacatatgctaaggaaatg
cctaatatagtagcatttggaccaatattccctggagaaccagatgttattcataaacca
aatgaatacattaaaatagatgacttaattttaataagcaaaatatatgcaaaagcttta
tatgaattagctaaataa

DBGET integrated database retrieval system