KEGG   Clostridium perfringens ATCC 13124: CPF_1509Help
Entry
CPF_1509          CDS       T00378                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPF_1509 (tpiA)
   01230 Biosynthesis of amino acids
    CPF_1509 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPF_1509 (tpiA)
   00051 Fructose and mannose metabolism
    CPF_1509 (tpiA)
   00562 Inositol phosphate metabolism
    CPF_1509 (tpiA)
Enzymes [BR:cpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPF_1509 (tpiA)
Exosome [BR:cpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPF_1509 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPF_1509 (tpiA)
  Exosomal proteins of melanoma cells
   CPF_1509 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1724426..1725172)
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKV
GAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNL
TPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSD
QANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAA
DFAQIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccaataatcgcaggaaactggaaaatgcactatacaatagacgaggctgtt
aaattagttgaagaattaaagccattagttaaagatgctaaatgtgaagttgttgtttgc
ccaacttttgtttgcttagacgcagttaaaaaagctgttgaaggaacaaacataaaagta
ggtgctcaaaacatgcactttgaagaaaaaggagcattcactggagaaatcgctccaaga
atgttagaagctatgaacatagattacgttataattggacatagtgaaagaagagaatac
ttcaacgaaacagatgaaacttgcaacaaaaaagttaaagctgctttcgcacacaactta
actccaatcctttgctgtggagaaactttagagcaaagagaaaacggaactactaacgac
gttataaaagctcaaatcactgctgatttagaaggattaactaaagagcaagctgagaaa
gttgttatagcttacgaaccaatctgggctatcggaactggaaaaactgctacttcagac
caagctaatgaaacaatagctgctataagagctatggttgctgaaatgttcggacaagaa
gttgctgataaagtaagaatccaatacggtggatcagttaagcctaacacaatagcagag
caaatggctaaatcagacatcgatggtgctttagttggtggagctagcttagttgcagct
gactttgctcaaatcgtaaactactaa

DBGET integrated database retrieval system