KEGG   Clostridium perfringens ATCC 13124: CPF_1689Help
Entry
CPF_1689          CDS       T00378                                 

Definition
precorrin-2 dehydrogenase
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPF_1689
Enzymes [BR:cpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CPF_1689
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CPF_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1911610..1912236)
Genome map
AA seq 208 aa AA seqDB search
MPINIISNKFHVKVIGGGKAATIKIKGLLEKGCYVHILSKEFSKEILDIENKNLKLEKGN
YYKEFIKDAHLIIIAVDESSLVHKISKDCEKEYKLYLNAANYKEGMVAIPYSRCYENLGF
SISSKLGSPRITRAIGEEVSNIIKENDIYSIKVAKIREKAKKEELKDNIIEIISSKEFKN
ALLEKREYEYLKNLLGEELANSLTLGLK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataaacattataagcaataaatttcatgttaaggtcataggtggaggaaaagca
gccaccataaagattaaaggattattagaaaaaggttgttatgtacatattttatctaag
gagttttcaaaggaaatcttagatattgaaaataaaaatttaaaacttgaaaagggaaac
tattataaagagtttataaaagatgctcatcttataataatagctgtggatgaaagttct
ctagtacataaaataagcaaggattgtgagaaagaatataaactatatttaaatgcagcc
aattataaagagggtatggtagctattccttacagtagatgttatgaaaatctaggcttt
agtataagtagtaaattaggatctcctaggataactagggctataggagaagaagtatca
aatattattaaggaaaatgacatatactcaattaaggtggcaaaaattagagaaaaagct
aaaaaagaagagttgaaggataatataatagagattatttcaagtaaagagtttaaaaat
gcccttttagaaaaaagagaatatgaatacttaaaaaatcttttaggagaagaattagct
aattcattaactttaggattaaagtaa

DBGET integrated database retrieval system