KEGG   Clostridium perfringens ATCC 13124: CPF_1689Help
Entry
CPF_1689          CDS       T00378                                 

Definition
precorrin-2 dehydrogenase
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(1911610..1912236)
Genome map
AA seq 208 aa AA seqDB search
MPINIISNKFHVKVIGGGKAATIKIKGLLEKGCYVHILSKEFSKEILDIENKNLKLEKGN
YYKEFIKDAHLIIIAVDESSLVHKISKDCEKEYKLYLNAANYKEGMVAIPYSRCYENLGF
SISSKLGSPRITRAIGEEVSNIIKENDIYSIKVAKIREKAKKEELKDNIIEIISSKEFKN
ALLEKREYEYLKNLLGEELANSLTLGLK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataaacattataagcaataaatttcatgttaaggtcataggtggaggaaaagca
gccaccataaagattaaaggattattagaaaaaggttgttatgtacatattttatctaag
gagttttcaaaggaaatcttagatattgaaaataaaaatttaaaacttgaaaagggaaac
tattataaagagtttataaaagatgctcatcttataataatagctgtggatgaaagttct
ctagtacataaaataagcaaggattgtgagaaagaatataaactatatttaaatgcagcc
aattataaagagggtatggtagctattccttacagtagatgttatgaaaatctaggcttt
agtataagtagtaaattaggatctcctaggataactagggctataggagaagaagtatca
aatattattaaggaaaatgacatatactcaattaaggtggcaaaaattagagaaaaagct
aaaaaagaagagttgaaggataatataatagagattatttcaagtaaagagtttaaaaat
gcccttttagaaaaaagagaatatgaatacttaaaaaatcttttaggagaagaattagct
aattcattaactttaggattaaagtaa

DBGET integrated database retrieval system