KEGG   Clostridium perfringens ATCC 13124: CPF_1718Help
Entry
CPF_1718          CDS       T00378                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPF_1718
   01230 Biosynthesis of amino acids
    CPF_1718
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPF_1718
   00030 Pentose phosphate pathway
    CPF_1718
   00051 Fructose and mannose metabolism
    CPF_1718
   00052 Galactose metabolism
    CPF_1718
  Energy metabolism
   00680 Methane metabolism
    CPF_1718
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPF_1718
Protein phosphatases and associated proteins [BR:cpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPF_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1941146..1942348
Genome map
AA seq 400 aa AA seqDB search
MNCIIAQSGGPTSVINASVYGLVKANKKLNLYENVYGGLNGIEGILNKKIINLSDLDELQ
LERFKNSPASGLGSCRYKLKPLSESEDEYLKLLDILNSLNIKAFFYVGGNDSMDTTAKLN
AFAKAKNIDIKFFGIPKTIDNDLMHTDHTPGFGSAAKFISTAVLETYLDSKVYTNNGIFI
IETMGRDTGWLAASGALATINGNKCADLVYLPERAFSVQSFLTDVARIFKEKKHVYIVAS
EGLKDENGKFLTETAPNDDSFGHAQLGGVGTYLKNLIIQASITHRVKSLELNTLQRCSMH
ASSKIDVNEAVMVGQAALEASINSEGGYMVAIRRDSSFPYKSSTFLIEADKIANNIKYFP
SEWINEEGNNITEEGLLYLKPLISDFEDRDSLPLYHSFVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtattatagctcagtctggcggacctacttcagtaataaatgctagtgtttat
ggtctagttaaagcaaataaaaaacttaatttatatgagaatgtttatggtggattaaac
ggaatagaaggtattttaaataagaaaataataaacctttcagaccttgatgaacttcaa
ttagaaagatttaaaaattcaccagcctctggtttaggttcttgtagatataaattaaaa
cctcttagcgaaagtgaagatgagtacttaaaacttttagatattttaaactcacttaat
ataaaagctttcttttatgtaggtggaaatgactcaatggatactactgctaaattaaat
gcttttgcaaaagctaaaaatatagatataaaattctttggaatccctaaaacaatagat
aatgatttaatgcacacagatcacactccaggatttggtagcgctgcaaaattcatatct
acagcagttttagaaacttatttagactcaaaagtttatactaataatggaattttcata
attgaaactatgggaagagatacaggttggttagcagcttctggtgccttagcaactata
aacgggaataaatgtgctgatttagtatatttacctgaaagagcattttcagtacaaagc
tttttaactgatgtagctagaatatttaaagaaaaaaaacatgtatatatagtagcttct
gaaggattaaaagatgaaaatggaaagtttcttactgaaactgcaccaaatgacgattca
tttggacatgctcaattaggtggtgtaggtacttacttaaagaacctaataatccaagct
agtataacacatagagttaaatctctagaacttaatactctacaaagatgttctatgcat
gcttcatctaaaatagatgtaaatgaagctgttatggtaggacaagctgccttagaagct
tctattaattcagaaggtggttatatggttgctataagaagagattcttcattcccatat
aaaagctctacttttttaattgaagctgataaaatagctaataatataaaatattttcca
agtgaatggataaatgaagaaggtaataatataaccgaagaaggtttattatatcttaag
ccattaattagcgattttgaggatagagattctcttcctctttatcatagttttgtttta
taa

DBGET integrated database retrieval system