KEGG   Clostridium perfringens ATCC 13124: CPF_2001Help
Entry
CPF_2001          CDS       T00378                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00230  Purine metabolism
cpf01100  Metabolic pathways
Module
cpf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPF_2001 (gmk)
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPF_2001 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 AAA_22 Thymidylate_kin Cytidylate_kin ABC_tran CPT ADK AAA_17 Zeta_toxin RsgA_GTPase AAA_29 AAA AAA_16 AAA_28 T2SSE AAA_30
Motif
Other DBs
NCBI-ProteinID: ABG82421
UniProt: Q0TPK6
Position
complement(2240603..2241253)
Genome map
AA seq 216 aa AA seqDB search
MMNKIHKDNRGVLIVISGPSGAGKGTICKALLEKHDDIFISVSATTRNPRVGEVDGVNYH
FLTKEEFKQRIAEDDFLEHAEVYGNYYGTPKSSVEKMLDEGKNVILEIDIQGALKVKEKA
TDGVFIFILPPSMEELKQRIIKRGSETPESLMTRFKSAYKEINYVSKYNYAVVNDNVEDA
VKKIEAILLAEKCRVDRLKENLLESKEDEMHEQLYD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataagatacataaggataatagaggtgtattaatagttatttctggtccttca
ggtgcaggtaagggaactatttgtaaagccttattagaaaaacacgatgatatattcata
tcagtttctgctactactagaaatcctagagtaggagaagttgatggagttaattatcat
ttcttaacaaaagaagaatttaaacaaagaatagcagaggatgatttccttgagcatgct
gaagtatatggaaattattatggaactcctaaatcaagtgttgaaaaaatgcttgatgaa
ggaaaaaacgtaatattagaaatagatatacaaggtgctttaaaagttaaggaaaaggct
actgatggagtatttatctttatattacctccttcaatggaagagcttaagcaaagaata
ataaaaagaggtagcgaaactccagaaagtttaatgactagatttaagtcagcttataaa
gaaattaattatgtgtcaaaatacaattatgcagtagttaacgataatgtagaagatgca
gtaaagaaaatagaagctatattattagcagaaaaatgtagagtagatagattaaaagaa
aacttattagagtcaaaggaggacgaaatgcatgaacaactctatgattaa

DBGET integrated database retrieval system