KEGG   Clostridium perfringens ATCC 13124: CPF_2251Help
Entry
CPF_2251          CDS       T00378                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPF_2251
   00330 Arginine and proline metabolism
    CPF_2251
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CPF_2251
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CPF_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2499939..2500856)
Genome map
AA seq 305 aa AA seqDB search
MKNFLESLIENNRQYVEHGKLASYIPELEKANKEDLGIYIVTLDGKEVGAGEYDKKFTIQ
SISKVITLMLAILDNGKDRVFSRVGVEPTGDSFNSIVSLERKPSKKPFNPMVNSGAILTT
SLIEGDSEEEKFERILEFTRKVTGNDDIQLNEDVYLSEKETGDRNRALAYFMKSNGVIEG
NIDDILDLYFKQCSLEVNAKDLARFGAMLANDGVLPWNGERVISREICRIIKTIMVTCGM
YDDSGKFAVHIGIPAKSGVGGGIMAAVPRRMGIGIFGPSLDDKGNSIAGTHVMKDLSEEL
DLSIF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattttcttgagagtttaatagaaaataatagacaatatgttgaacatggaaaa
ctggcatcttatattccagaattagaaaaagctaataaagaagatttaggtatatatata
gttactcttgatggaaaagaagtaggggcaggagagtatgataaaaagtttactattcag
agtatatcaaaagtaataactttaatgcttgcaatattagataatggaaaagatagagtc
ttttcaagagtaggtgttgaaccaactggagatagctttaatagtatagtaagtttagag
agaaagccttctaaaaaaccttttaaccctatggttaattcaggagcaatattaacaaca
tctttaattgaaggtgatagtgaagaggaaaagtttgagagaattttagaatttactaga
aaagtaacaggaaatgatgatattcaattaaatgaagatgtttatttatctgaaaaggaa
actggagatagaaatagagccttagcatactttatgaaaagtaatggagttatagaagga
aatatagatgatatattagatttatatttcaaacaatgttctctagaagttaatgctaaa
gatttagctagatttggtgctatgcttgctaatgatggagtattaccttggaatggagaa
agagtaatatctagagaaatttgcagaataataaaaacaataatggttacttgcggtatg
tatgatgactcaggtaaatttgctgtacatataggaattccagcaaaaagtggagttggt
ggcggaataatggctgctgttccaagaagaatgggaataggtatttttggaccttcttta
gatgataagggaaatagtatagcaggaacacatgttatgaaggatttatctgaggaatta
gatttaagtattttctaa

DBGET integrated database retrieval system