KEGG   Clostridium perfringens ATCC 13124: CPF_2433Help
Entry
CPF_2433          CDS       T00378                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPF_2433
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPF_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2708929..2711163)
Genome map
AA seq 744 aa AA seqDB search
MEALNGIVESIVFKSSDTGYTVIKFRENNIIHTAVGVLPHVKEGQNLKITGSWVNHSQFG
KQFKVEECEEILPTSKDGIEKYLSSGIIQGIGPVTAKKIVNKFGEDTLNILDNNIERLKE
IEGIGKKKLETIIESYREQRELKNITIFLQTHGLSVNQCLKIYKKYGASSVDTVKNNPYI
LCDEISGIGFKTSDKIARSLGIEIDSPFRIQSGIRYVINEFCANGHTFMPKDELIKEASN
VLTVSGDIIEENIKNAALDRKIKLEKVNDKEGVFTIPNYYCELGITNRILTLAISNFQDI
SVDVEHLILQFEKKNNITFAESQKDAIISAFQNGIEIITGGPGTGKTTIIKCIIEIFETC
GLKVLLGAPTGRAAKRMSESTGKEATTIHRMLDMGVFEKEESVFVTNAEEHSLEADVVII
DEASMIDITLMNALLKSIKVGTRLIIVGDVDQLPSVGAGNVLNDFIESGFTKVVRLKEIF
RQGKESMIVVNAHKINKGEMPKLNEKGTDFFFIRNDIQEGILNTIIDLINTRLPKFNSNW
DKLKSIQVLVPMKKGVLGVTNLNERIQNVLNPKAPYKKEKEFRSMVFREGDKVMQIKNNY
SLKWTRIAGKGEHEGLGVFNGDMGFIESIDLEGKKLSIIFDDERRVIYDFMYLDELDLAY
AITIHKSQGSEFPVVIIPAYMGAPLLMNRNLLYTGITRAKEMVVVVGIPKALKYMVDNTR
SMERYSSLNWRIKEVISNEVFEQD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattaaatggaatagttgagagtatagtatttaaaagctcagatacagggtat
acagttataaaatttagagaaaataatattattcatacagcagtgggagttttaccacat
gtaaaagaaggtcaaaatttaaaaattacaggaagttgggttaaccattcccagtttgga
aaacaatttaaggtagaagaatgtgaagagatattacctacttcaaaggatggaatagaa
aaatatttatcttctgggataatacagggaataggacctgttacggcaaaaaaaattgta
aataaatttggagaagatactcttaatattttagataataatattgagagattaaaagaa
atagaaggaataggtaaaaagaagttagagaccataattgagtcttatagagaacaaaga
gaattaaaaaatataactatatttttgcaaacccatggattaagtgtaaatcaatgtttg
aagatttataaaaaatatggagctagttcagttgatacagttaaaaataatccatatata
ctttgtgatgaaatttcaggaataggatttaagacttctgataagattgctagaagttta
ggaatagaaattgactcaccttttagaattcaaagtggtataagatacgtaataaatgaa
ttttgtgctaatggacatacttttatgccaaaggatgaacttataaaggaagcaagtaat
gtattaactgtaagtggagatataatagaagaaaatattaaaaatgcagctttagataga
aaaataaagttagagaaagttaatgataaagaaggtgttttcacaatacctaattattat
tgtgagcttggaataactaataggattttaactttagctataagcaatttccaagatata
agtgtagatgttgagcacttaatacttcaatttgaaaagaaaaataatataacttttgca
gaatcccagaaagatgctataataagtgcttttcaaaatggaatagagataataactggg
ggaccaggaacaggaaagaccactataataaagtgtataattgaaatttttgaaacttgt
ggtttgaaggttcttttgggagcacctactggaagagcggctaaaagaatgagtgaatct
acaggaaaagaagctactacaatacatagaatgcttgacatgggagtctttgaaaaagaa
gaaagtgtttttgtaaccaatgcagaggaacattccttagaggctgatgtggttataata
gatgaggcatcaatgattgatataactttaatgaatgctttacttaaatctattaaggta
ggtactaggcttataatagtaggagatgttgatcagcttccatcagtaggagctggaaat
gtattaaatgattttatagagagtggatttacaaaggttgtacgtctaaaggaaatattt
agacaaggaaaagagagtatgattgtagtaaatgcacataaaataaataaaggtgagatg
cctaagttaaatgaaaaaggtactgatttcttcttcataagaaatgatattcaagaggga
atattaaatactattatagatttaataaatactaggttgcctaagtttaactcaaattgg
gataagttaaaaagtatacaggttttagttcctatgaaaaagggtgtattaggagttaca
aatttaaatgaaagaattcaaaatgtcttaaacccaaaggctccatataaaaaagaaaaa
gaatttagaagtatggtatttagagagggagataaggttatgcagataaagaataactac
tctctaaaatggaccagaatagctggaaaaggtgagcatgaaggcttgggtgtatttaat
ggagatatgggatttatagaaagtatagatttagaagggaaaaaactatctataatcttt
gatgatgaaagaagagttatttatgattttatgtatttagatgaattagatttagcttat
gcaatcacaatacataaaagtcaaggaagtgaattccctgtagtaataatacctgcatat
atgggtgcaccattacttatgaatagaaatttattatatacaggaataactagggcaaaa
gaaatggttgtagtagttggaatacctaaagcattaaaatatatggttgataatacaagg
agtatggaacgttattcctctttaaattggagaataaaagaagtaatatctaatgaggtt
tttgaacaagattaa

DBGET integrated database retrieval system