KEGG   Clostridium perfringens ATCC 13124: CPF_2433Help
Entry
CPF_2433          CDS       T00378                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(2708929..2711163)
Genome map
AA seq 744 aa AA seqDB search
MEALNGIVESIVFKSSDTGYTVIKFRENNIIHTAVGVLPHVKEGQNLKITGSWVNHSQFG
KQFKVEECEEILPTSKDGIEKYLSSGIIQGIGPVTAKKIVNKFGEDTLNILDNNIERLKE
IEGIGKKKLETIIESYREQRELKNITIFLQTHGLSVNQCLKIYKKYGASSVDTVKNNPYI
LCDEISGIGFKTSDKIARSLGIEIDSPFRIQSGIRYVINEFCANGHTFMPKDELIKEASN
VLTVSGDIIEENIKNAALDRKIKLEKVNDKEGVFTIPNYYCELGITNRILTLAISNFQDI
SVDVEHLILQFEKKNNITFAESQKDAIISAFQNGIEIITGGPGTGKTTIIKCIIEIFETC
GLKVLLGAPTGRAAKRMSESTGKEATTIHRMLDMGVFEKEESVFVTNAEEHSLEADVVII
DEASMIDITLMNALLKSIKVGTRLIIVGDVDQLPSVGAGNVLNDFIESGFTKVVRLKEIF
RQGKESMIVVNAHKINKGEMPKLNEKGTDFFFIRNDIQEGILNTIIDLINTRLPKFNSNW
DKLKSIQVLVPMKKGVLGVTNLNERIQNVLNPKAPYKKEKEFRSMVFREGDKVMQIKNNY
SLKWTRIAGKGEHEGLGVFNGDMGFIESIDLEGKKLSIIFDDERRVIYDFMYLDELDLAY
AITIHKSQGSEFPVVIIPAYMGAPLLMNRNLLYTGITRAKEMVVVVGIPKALKYMVDNTR
SMERYSSLNWRIKEVISNEVFEQD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattaaatggaatagttgagagtatagtatttaaaagctcagatacagggtat
acagttataaaatttagagaaaataatattattcatacagcagtgggagttttaccacat
gtaaaagaaggtcaaaatttaaaaattacaggaagttgggttaaccattcccagtttgga
aaacaatttaaggtagaagaatgtgaagagatattacctacttcaaaggatggaatagaa
aaatatttatcttctgggataatacagggaataggacctgttacggcaaaaaaaattgta
aataaatttggagaagatactcttaatattttagataataatattgagagattaaaagaa
atagaaggaataggtaaaaagaagttagagaccataattgagtcttatagagaacaaaga
gaattaaaaaatataactatatttttgcaaacccatggattaagtgtaaatcaatgtttg
aagatttataaaaaatatggagctagttcagttgatacagttaaaaataatccatatata
ctttgtgatgaaatttcaggaataggatttaagacttctgataagattgctagaagttta
ggaatagaaattgactcaccttttagaattcaaagtggtataagatacgtaataaatgaa
ttttgtgctaatggacatacttttatgccaaaggatgaacttataaaggaagcaagtaat
gtattaactgtaagtggagatataatagaagaaaatattaaaaatgcagctttagataga
aaaataaagttagagaaagttaatgataaagaaggtgttttcacaatacctaattattat
tgtgagcttggaataactaataggattttaactttagctataagcaatttccaagatata
agtgtagatgttgagcacttaatacttcaatttgaaaagaaaaataatataacttttgca
gaatcccagaaagatgctataataagtgcttttcaaaatggaatagagataataactggg
ggaccaggaacaggaaagaccactataataaagtgtataattgaaatttttgaaacttgt
ggtttgaaggttcttttgggagcacctactggaagagcggctaaaagaatgagtgaatct
acaggaaaagaagctactacaatacatagaatgcttgacatgggagtctttgaaaaagaa
gaaagtgtttttgtaaccaatgcagaggaacattccttagaggctgatgtggttataata
gatgaggcatcaatgattgatataactttaatgaatgctttacttaaatctattaaggta
ggtactaggcttataatagtaggagatgttgatcagcttccatcagtaggagctggaaat
gtattaaatgattttatagagagtggatttacaaaggttgtacgtctaaaggaaatattt
agacaaggaaaagagagtatgattgtagtaaatgcacataaaataaataaaggtgagatg
cctaagttaaatgaaaaaggtactgatttcttcttcataagaaatgatattcaagaggga
atattaaatactattatagatttaataaatactaggttgcctaagtttaactcaaattgg
gataagttaaaaagtatacaggttttagttcctatgaaaaagggtgtattaggagttaca
aatttaaatgaaagaattcaaaatgtcttaaacccaaaggctccatataaaaaagaaaaa
gaatttagaagtatggtatttagagagggagataaggttatgcagataaagaataactac
tctctaaaatggaccagaatagctggaaaaggtgagcatgaaggcttgggtgtatttaat
ggagatatgggatttatagaaagtatagatttagaagggaaaaaactatctataatcttt
gatgatgaaagaagagttatttatgattttatgtatttagatgaattagatttagcttat
gcaatcacaatacataaaagtcaaggaagtgaattccctgtagtaataatacctgcatat
atgggtgcaccattacttatgaatagaaatttattatatacaggaataactagggcaaaa
gaaatggttgtagtagttggaatacctaaagcattaaaatatatggttgataatacaagg
agtatggaacgttattcctctttaaattggagaataaaagaagtaatatctaatgaggtt
tttgaacaagattaa

DBGET integrated database retrieval system