KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0160Help
Entry
Cp316_0160        CDS       T01753                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151153..151809
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgctcaacgcatcgcttttcacttgcttcatgtggagcctgcggacatcgca
agacttcaggatgccctcggtgctgtccgagatggcgtgaccttttgtcgtatttgctgc
aatatctcccgcgaatcggtatgccgtatttgtgcggattctggccgggatcggggaacg
atctgcgtggtggaggaacccaaagatattcaggttattgagcggacgggcgaatataat
ggccgctaccatgtgctgggtggggcgttggatccgctagctaatattggtccccgtgaa
ctgaatatttctacgttgctgcagcgcattggaggggtgcttcccgatcgagagctagcg
gattctacgcctgatgcgccgctgtatgattcctctccgacggtgacagaggttattctt
gccaccgaccccaataccgagggtgaggcgacggcttcttatcttgcacgtctgctccga
gattttcctgatttggtggtttctcgtctggcttccggtatgcctttgggcggggaccta
gaatttgtggatgaactgacattgtcccgcgccctgagcggtcgattgacaatttaa

DBGET integrated database retrieval system