KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0288Help
Entry
Cp316_0288        CDS       T01753                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288964..290349
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLA
FREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMGIPGTSEDLGNLVSEET
RKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSALQGGVYSSTSDDLSVRATVP
QLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSVFASFAGGYAEMYEALAER
SEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPTAALLLKNLVPEAAQQLKTI
KLASSAVVGMKFDNSAGLPDNSGILVATNTQDVRAKAFTFSSKKWPHLGERGGALVRASF
GRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLDTV
AAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccatcatcggtgccggtttagcggggctaacggctgcttatgagattcat
aaactcgcccctcacgcggacgtagaggtgttcgaggcgacagatcgaattggcggcaaa
ctgttcacggttccgtttgcctccggtcctactgatatgggcgcagaagcatatttagct
tttcgggaagataccactgaatttttcaaagagctagggctcgaggagagtttgcgttcc
ccctcggggttgccttctttgctataccagggaggcagccttcatagcatgccttccaac
acgatcatgggtatccccggcacaagtgaggacctaggtaacctggtcagtgaggaaact
cgcaaacgcattgactcggaaataaacgcggagtctattgagtggcctcaagaaataagc
ctgggtgcactcctgcgggaacgcttgggtgatgatgttgtagatcatgtggtgtcggcg
ctgcaaggtggcgtttattcttctacctcggatgatctcagcgtgcgcgctacggtaccg
cagctagcgcgggccttagacaagctcaaagaagagggaaagcccgtaaccatcacgggt
gctgttcaacgacttttgtctgagcgagaggaacgtaacaaaaaacggggatataccccg
agcgtttttgcgtctttcgcaggcggctatgcggagatgtatgaggctcttgctgagcgt
agcgaggcaaagatccacatcgatgcctttattaccgcagtggataaaaagcctgagggt
tttgtgctcaagggtgctgaaggcgtctttgataaagtcctgttgacggtgccggcgccc
acggcggctctgctgcttaagaaccttgttccggaggctgcacaacagcttaaaactatc
aagctagcgagctctgccgtggtaggaatgaagtttgataattccgcgggactccctgat
aactctgggattcttgttgccactaatacccaagacgtgagggcaaaagcattcaccttt
tcctctaagaagtggcctcacctgggggaacgtggcggtgctttagtgcgggcctctttc
ggtaggtttggtgaggacgctatcgcgcgcgcagacgaagacgagcttgtcgacgcagcc
ctcgacgacctacagaccattacgggattcgacggacgtgctgctggattatcggagatc
tttgtccagcgatggttcggcgggttgccagtgtatggtcctgggcacttggacacggtt
gcagcaatcaagaaagcactggctcaggtcgagggcatcgatgctactggtgcgtgggcc
gatggcgtcggcgttcccgcagtgatcgatgctgcgaaagcagcggccaaacgagcactt
gcctaa

DBGET integrated database retrieval system