KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0632Help
Entry
Cp316_0632        CDS       T01753                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00071  Fatty acid degradation
cpg00280  Valine, leucine and isoleucine degradation
cpg00310  Lysine degradation
cpg00360  Phenylalanine metabolism
cpg00380  Tryptophan metabolism
cpg00410  beta-Alanine metabolism
cpg00627  Aminobenzoate degradation
cpg00640  Propanoate metabolism
cpg00650  Butanoate metabolism
cpg00903  Limonene and pinene degradation
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01120  Microbial metabolism in diverse environments
cpg01130  Biosynthesis of antibiotics
cpg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp316_0632 (echA6)
   00650 Butanoate metabolism
    Cp316_0632 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp316_0632 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp316_0632 (echA6)
   00310 Lysine degradation
    Cp316_0632 (echA6)
   00360 Phenylalanine metabolism
    Cp316_0632 (echA6)
   00380 Tryptophan metabolism
    Cp316_0632 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp316_0632 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp316_0632 (echA6)
   00281 Geraniol degradation
    Cp316_0632 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp316_0632 (echA6)
   00627 Aminobenzoate degradation
    Cp316_0632 (echA6)
   00930 Caprolactam degradation
    Cp316_0632 (echA6)
Enzymes [BR:cpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp316_0632 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFB71948
Position
635999..636835
Genome map
AA seq 278 aa AA seqDB search
MLEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLDERSQSLFSQCWSSQDMREARQARLEKRVPQFKGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaggctaat
tactcgttggatgagcgctcacaatccttattttcccagtgctggtctagtcaggatatg
agggaagcgcgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system