KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0690Help
Entry
Cp316_0690        CDS       T01753                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00040  Pentose and glucuronate interconversions
cpg00052  Galactose metabolism
cpg00500  Starch and sucrose metabolism
cpg00520  Amino sugar and nucleotide sugar metabolism
cpg01100  Metabolic pathways
cpg01130  Biosynthesis of antibiotics
Module
cpg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cp316_0690 (galU)
   00052 Galactose metabolism
    Cp316_0690 (galU)
   00500 Starch and sucrose metabolism
    Cp316_0690 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp316_0690 (galU)
Enzymes [BR:cpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cp316_0690 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFB72004
Position
692841..693797
Genome map
AA seq 318 aa AA seqDB search
MDTGCTLICMKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIEL
IAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPV
SVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCA
FEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFD
ALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPA
YGPHLKKVLRKILEEHGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggatgtactcttatctgcatgaagcagcctcaagaagctcaagacagtacg
cgcgtcgcggtgaagactgtcatcgttcctgctgctggcatgggaacgagattccttcct
gccacaaaaacggttcctaaagaactattgccagtggtagataccccaggcattgaactg
attgcagaagaagcagctcagttgggggcaactcgactcgcagtaattacggctcctaat
aagcaggaagtcatggagcactttaagcgattcccagtgttggaagagaccctacaaagc
cggggcaaaaccgaacaatatgaaaaagttgttcatgcctctgagcttattgcgccagtt
tccgtagtgcaggaaaagccgctcggccttgggcatgctgttggcatggcggaatcagtc
cttgatcctgatgaggacgctgtagcagtcatgcttcccgatgatctagtgcttccgcgg
ggcgtcgtggagaagatggtcgaggtacgcgagcaactaggcggatctgtgttgtgcgcc
tttgaagtgccggaggaagaagtctataactacggtgtctttgagatcgatgagagtgca
tatgatggccctcatcacgtcaaaaaagtcaaaggaatggtagaaaaaccctctgtagaa
gaggctccttcaaattttgtggctaccggccgctatttgctcgaccgggctatttttgat
gcactccgtagaattaccccgggtgctggcggtgagctgcaactcacggatgccattgat
ttgcttatcgacgaaggccaccctgtgcatattcttgtgcatgacgggaagcgtcatgat
cttggcaaccccgggggatacataccggctgttgttgattttgggttgcgcgatccagcg
tatgggccgcacttaaagaaggtcctccgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system