KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0705Help
Entry
Cp316_0705        CDS       T01753                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710689..711648
Genome map
AA seq 319 aa AA seqDB search
MIEENPELKHGKRITATAHSKVNLHLGVGPRRHDGYHELVTIFQSLSLKDEVECVELRGT
ATDQKSGIVAELDAYEADGVPTDNSNLAWKAADMVYAFHRSGGGPPLNKVRICLKKGIPT
AGGMAGGSADAAAALRLMQEYVTVKPTDKQLLTMASALGSDVPFTLLGGTRLGTGRGENL
VHVMSRGQYHWALAFSTQGLSTPAVFAKLDQMQRTPHLSVDDLTAALISGDSYHVAQYLH
NDMQPAALSLQPGLRKTLEVGKASGALAGIISGSGPTCAFLCPDAESAEDVAAELRLIGP
AATATGPALGATISTTTRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggagaatccggagcttaagcacggcaaacgcatcacagcaaccgcgcattca
aaagtgaacctccaccttggagtgggcccgcggcgccacgacggctatcacgagcttgtc
actatttttcaatctttgagccttaaagatgaagtggaatgcgtagaactacgtggcact
gcaaccgatcaaaaatccggaatcgtagctgagcttgacgcctatgaggctgacggagtt
cctaccgataacagcaatcttgcgtggaaagccgccgatatggtctatgcttttcatcgt
tctgggggcggacctcccctgaacaaagtacggatctgcttaaaaaagggaattcctaca
gccggcggcatggcaggaggctcagcagacgctgctgcggcgcttcggcttatgcaggaa
tacgtcacagtaaaaccaactgataagcagctactcactatggccagcgccttaggatcg
gacgttcctttcacgcttttaggcggcacgcggctgggaaccgggcgtggagaaaacctc
gttcacgttatgtcccgaggccaatatcattgggcgttagctttttctacacaaggtctt
agcactcctgcggtctttgccaagctagatcagatgcaacgcaccccgcacttatccgta
gatgatctgacagcagcgctgattagcggagactcgtaccacgtagctcagtatcttcac
aacgatatgcaacctgcagctctttcccttcagccaggtttgagaaaaactctggaggtg
ggtaaggcctcaggcgcgctggcagggattatttctggctctggccccacctgcgctttt
ctttgcccggatgcggaaagcgccgaggacgtagccgcagagctgcggcttataggacca
gctgcaaccgcaacaggtccagcgctaggcgctaccatttccaccacaaccagatcatag

DBGET integrated database retrieval system