KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0887Help
Entry
Cp316_0887        CDS       T01753                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(896257..898455)
Genome map
AA seq 732 aa AA seqDB search
MFSASDPIRIDDDVLGRLRYCQFHDPHGVYGCHRIDDSRAVIRTRQLGAEAVTVTLTDGT
TYALSPIGDDIFAATVDASLSSDYRLNVSWPGDTMVTTADPYHFLPTLGELDIHLIREGR
HERLWDVLGAHVRTFTTDLGEVTGTSFAVWAPNATGVAVVGDFCGWNPNQYPMRSLGDSG
VWELFIPGIQAGDVYKYAIHTREGHRIDKADPLARHAEVAPATGSIVADSSYEWNDADWM
SQRATRDHATQPMSIYECHLGSWRENRTYKDLASELVDYVSALGYTHVEFLPVAEHPFGG
SWGYQVSGYYAPTSRWGTPDEFRMLIDAFHRAGIGVIMDWVPAHFPKDSFALGRFDGEAL
YEHPDWRRGEQKDWGTYVFNFGRNEVRNFLVANALYWIDEFHVDGLRVDAVASMLYLDYS
REAGEWLPNVYGGRENLEAVQFLQEMNATVHKTFPGVLTIAEESTSWPGVTTPTDHNGLG
FSMKWNMGWMNDTLEYFSLDPIHRAYHHNEITFSMVYAYSERFVLPFSHDEVVHGKGSLW
TRMPGDAWNKASGLRALYAYMYAHPGRKLLFQGQEFGQVMEWSEGRSLDWDNLVGWEGEY
HEGLIKLIRDLNFVYQDNPALYTQDNGPEGFSWAKSNDAGNNILSFIRYGSAGEKILAVF
NFSGSSQPHYKLGVPEGGRWECILNTDAGVYEGANNLLEQTVTAWDTEWDGYEHSLTVHI
PAMSGQFYRWID
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgcttctgatcccatccgcatcgacgatgatgttcttggccggctgagatac
tgtcagttccatgacccccacggggtctatggttgccaccgtatcgatgactcccgtgct
gtcatccgtactcgccaacttggcgcggaagctgtcacagtcacgctcacagatggaaca
acatatgcgctttcccccatcggggatgatatattcgcagccaccgtagacgcgtctctg
tccagcgactataggctcaacgtctcgtggcccggagacacaatggtgaccactgctgat
ccttatcatttccttcctacgctgggagaactagatattcatctcatccgagagggaagg
catgaacgcctctgggatgttctaggggcacatgttcgcacttttaccacggatctaggt
gaggtaacaggcacatcctttgccgtatgggcgcccaatgccacaggagttgctgttgtt
ggcgatttttgtggatggaaccccaaccaataccccatgcgctcgctaggagactcaggt
gtctgggaactatttattccgggtattcaagctggagacgtgtacaaatacgcaattcat
acccgcgaggggcatcggatagacaaagccgacccgctagcgcgccatgcagaagtagcg
cctgctacggggtccatcgtcgcagattccagttatgaatggaatgacgcggactggatg
tctcaacgcgcaactcgcgaccatgcaacgcaaccgatgagcatctacgagtgccatctg
ggctcttggagagaaaaccggacgtataaagacctcgcctcagaactggtcgactacgtt
tctgctctcggatacacccacgtagagttccttcccgtggcagagcacccctttggtgga
tcttgggggtaccaggtctctggctactacgcacccacatcgcgctggggaaccccagat
gagttccgcatgcttatcgacgctttccaccgcgctggcatcggagtcattatggactgg
gtacccgcgcatttccccaaagattcttttgctctgggacgcttcgacggtgaggcgctc
tacgaacaccctgactggcgtcgaggagagcaaaaagattggggcacctatgtctttaat
ttcgggcgcaatgaagtccgcaatttcctggtagctaacgcactttattggatagatgaa
ttccatgtcgatggtctacgtgtggacgccgttgcgtcaatgctctatctcgactactcc
cgagaggccggcgaatggctaccaaatgtctatggaggccgtgaaaatctcgaggcagtc
caattcctgcaggagatgaacgccactgtgcataagaccttccctggtgttcttaccatc
gcggaagaatcgacttcttggcctggagttaccactcctactgaccacaatggccttggt
tttagcatgaagtggaacatgggctggatgaatgacacccttgagtatttctctttggac
cccattcatcgcgcttatcaccacaatgagattacgttctctatggtctatgcctattca
gaacgttttgttcttccgtttagtcatgacgaagtagtccacggcaagggatcgctatgg
actcggatgcctggtgacgcatggaacaaagccagcggattacgcgccctctacgcctat
atgtacgctcacccaggcagaaagctgttgttccaaggacaagagtttggtcaggtcatg
gaatggtctgaggggcgctctcttgattgggataaccttgtagggtgggaaggcgagtat
cacgaggggttgataaagctcatccgcgatctcaactttgtgtaccaagacaaccctgcg
ctctatacccaggataatggccctgaaggctttagctgggctaagtccaatgatgcaggc
aacaatatcttatctttcatccgctatggttctgccggagaaaaaattcttgcagtattt
aacttcagcgggagctctcagccacattacaagctgggggtaccggaaggcggacgttgg
gaatgcatactcaacaccgatgcgggcgtatatgaaggcgctaataatcttctggaacaa
actgttaccgcctgggacaccgagtgggacgggtacgagcattccctcacagttcatatt
cctgcgatgagtggtcaattttatcgctggatagactaa

DBGET integrated database retrieval system