KEGG   Corynebacterium pseudotuberculosis 316: Cp316_0910Help
Entry
Cp316_0910        CDS       T01753                                 

Gene name
pfkA
Definition
6-phosphofructo kinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp316_0910 (pfkA)
   01230 Biosynthesis of amino acids
    Cp316_0910 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp316_0910 (pfkA)
   00030 Pentose phosphate pathway
    Cp316_0910 (pfkA)
   00051 Fructose and mannose metabolism
    Cp316_0910 (pfkA)
   00052 Galactose metabolism
    Cp316_0910 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Cp316_0910 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cp316_0910 (pfkA)
Enzymes [BR:cpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cp316_0910 (pfkA)
Protein phosphatases and associated proteins [BR:cpg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cp316_0910 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921752..922780
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAELDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDINEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVRAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggtggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaacttgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgttcccaaaactatcgataatgatgtcaatggtaccgattacacctttggctttgac
accgcagtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatatcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaatggcatcggccaggtgatcggcgaagaaataaagaggcgc
ctaggtcatgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcgggcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system