KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1172Help
Entry
Cp316_1172        CDS       T01753                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1215074..1215649)
Genome map
AA seq 191 aa AA seqDB search
MTGDNPKGRLVVLVWSICCGKVHGGSSPSRGSTKPIFSVSMTTRAPRPGEVDGVDYFFVT
PEEFQSRIDGGEMLEWAEIHGGLQRSGTPAGPVEDALLAGRPVLVEVDLIGARNVAALKP
DAETVFLAPPSWEVLVDRLTGRGTEPEDVIKRRLETARQELASQDEFKHVVTNDKVDKTV
AEIRDILLGCC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgataacccaaaaggtcggctagtcgttttagtctggtccatctgctgtggg
aaagtccacggtggttcatcgccttcgcgaggaagtaccaaacctatatttagtgtgtcg
atgaccacgagggctcctcgtcctggtgaagtcgatggtgtggattatttcttcgtgact
cccgaggagtttcagtctcgtatcgacggtggagaaatgctcgagtgggcagagatccat
ggtgggctgcagaggtctgggactcccgcggggcctgtggaagacgcgttattggccggt
cgtcctgtgctggttgaagttgatcttattggtgctcgtaacgtcgcggcgttgaagcct
gatgcagagaccgttttcctagctccgccgtcatgggaagtccttgtagaccgtcttact
gggcgaggaacggagcccgaagacgtgatcaagaggcggctggaaactgcacggcaggag
ctagcatcccaggatgagtttaagcacgttgtaaccaacgataaagttgataagacggtc
gctgagattcgggatattctgctcgggtgctgctaa

DBGET integrated database retrieval system