KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1343Help
Entry
Cp316_1343        CDS       T01753                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1395942..1397024)
Genome map
AA seq 360 aa AA seqDB search
MGTCGRTLYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLGEA
PLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTDVR
AEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASMVEDEDIRVAAELALPHRRRRDPFDEPGLDQEQLDQ
EMEKARDQHPDASDKAEESQCEKEQHGLENKSSETQSEQPTSDGQEECATTGAPFRSTGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatcctttctctgcagtagtagggcaggagcgatta
agacttgcactactcttatgcgcaatttctccgcgtattggtggtgtagttatccgcggg
gaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctaggagaagcc
cctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctggatatg
gagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaagcagac
ggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgattcgctc
ttagacgcggcggcaacgggacaagtaacagttgaacgggatggcatttcttattcttct
cctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcggccgcaa
ttgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgatgtacga
gcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgctcaagcg
tggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacgagtgcag
cagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagcatttgac
gtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgctgcctgg
cgcggagcttcaatggttgaagatgaggatatccgggtagccgcagagttggccttgccg
catcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctggatcaa
gaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagagtctcag
tgtgaaaaagagcagcatggactagagaacaagtcttcggagactcaatctgagcagccc
accagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacgggtgct
taa

DBGET integrated database retrieval system