KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1404Help
Entry
Cp316_1404        CDS       T01753                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01130  Biosynthesis of antibiotics
cpg01230  Biosynthesis of amino acids
Module
cpg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp316_1404 (trpC2)
Enzymes [BR:cpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp316_1404 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFB72705
Position
complement(1469268..1470089)
Genome map
AA seq 273 aa AA seqDB search
MGRVMPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEI
KRAAPDKGVLAEINSPVGLAKELVAGGASLIACQTEWRRFHGSLSEMAEIRNVISVPIMC
RDFIVDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRA
VAAGAKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADA
VVVGEKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggacgggttatgccatcagtcttcgaagagattattgcgggcgtcattgaagatgta
gctgcgcgagaatcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgag
ccgcctcgggatgcaatagcggcgcttcttaatagtggttgtggtgtgatcgctgagatt
aaacgtgctgctccagataaaggcgttttagcagagatcaattctcctgttggcttagca
aaagaacttgtcgccgggggcgctagtttgattgcgtgtcagacggaatggcgaaggttc
cacggttcattatctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgc
cgagactttatcgtggatccctatcaaattcatgaggcacgctgttatggagcggacatg
gtgcccttgcgcgtagctgctttagaccaagccaggatgattgcgcttatagatagaatc
gagtccctggggatggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcg
gtggcagcgggtgcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctc
aaccgcctggccttcgcagaaattgctcctggacttcctacagatgttattagagttgca
ttgtccggtgtgcgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcg
gtggttgtgggagaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttg
gtggcagcaggccaacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system