KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1473Help
Entry
Cp316_1473        CDS       T01753                                 

Gene name
glk
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00010  Glycolysis / Gluconeogenesis
cpg00052  Galactose metabolism
cpg00500  Starch and sucrose metabolism
cpg00520  Amino sugar and nucleotide sugar metabolism
cpg00521  Streptomycin biosynthesis
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01120  Microbial metabolism in diverse environments
cpg01130  Biosynthesis of antibiotics
cpg01200  Carbon metabolism
Module
cpg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp316_1473 (glk)
   00052 Galactose metabolism
    Cp316_1473 (glk)
   00500 Starch and sucrose metabolism
    Cp316_1473 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp316_1473 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp316_1473 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp316_1473 (glk)
Enzymes [BR:cpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp316_1473 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR FGGY_N DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AFB72774
Position
complement(1540793..1541746)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDNLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIVIGGGVSTASALYIDTAVETMAASMGGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataacctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccgcaccttccgtggagagatcggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacaggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccaggggggcgaacatgttcctgcggtaaacgaggctgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcctgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattgtg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatgggtggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

DBGET integrated database retrieval system