KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1497Help
Entry
Cp316_1497        CDS       T01753                                 

Gene name
aceF
Definition
Dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpg01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cpg00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cpg00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562434..1564425
Genome map
AA seq 663 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGTILEIL
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTV
DVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESV
TEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIA
IIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPLVR
KLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGPEPAQKEAPAAVKDPRANWSTKSVDP
AKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEKYG
VNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIHKA
QELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILG
TAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQDD
LNL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcaccgagggaacaattacc
caatggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
acggacaaggttgacaccgaggttccttcccccgttgccggcaccatcctagaaatcctc
ttcaacgaagacgacaccgttgacgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccaaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgaactcggcgaatccgtcaccgagggaacaattacccaatggctcaagtctgtcggc
gacaccgtcgcagtcgacgagccgttgctcgaggtttccaccgacaaggttgacaccgag
gttccttcccccgttgccggcaccatcctagaaatcctcttcaacgaagacgacaccgtt
gacgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagcgat
tctgatgagaagaaggaagagccaaagcaggaagcacccaaggcagaacccaccaaggaa
gcacctaagggctccgggtcctccaccgacgtggtcatgcctgaactcggcgaatccgtc
accgagggaacaattacccaatggctcaagtctgtcggcgacaccgtcgcagtcgacgag
ccgttgctcgaggtttccaccgacaaggttgacaccgaggttccttcccccgttgccggc
accatcctagaaatcctcttcaacgaagacgacaccgttgacgtcggcgatgttatcgcc
atcatcggtgaggaaggtgaggctcctgccgcaagcgattctgatgagaagaaggaagag
ccaaagcaggaagcacccaaggcagaacccaccaaggaagcacctaaggaagaaccggct
aaagaggctgcaaagccagtcgataaccaaaacgttccttatgtgaccccattggtacgc
aagcttgctaataagtacggcgttgacctcaataaggtcgaaggcactggcgttggcggc
cgtatccgtaagcaagacgttctcgccgcagccgggcaaggacctgagccggctcaaaaa
gaagcccctgctgctgttaaggatcctcgcgctaactggtccaccaagagcgttgatcct
gcaaaggcagagcttattggtaccacccagaaggtcaaccgcatccgcgagatcacggct
aagaagatggtcgaggcgttgcagatttctgcacagctcacgcatcttcaagaggtggat
atgaccaacgttgccacgctgcgcaaggacaacaagccggcattcatcgaaaagtatggc
gttaacctgacctacctgccgttctttgttaaggccgtggttgaggctctagtcctgcac
ccgaacgtgaatgcgtcttacaacgctgccaccaaggagatcacttaccactccgacgtc
aatattgcgattgcagtggataccgagcgcggtctgctcacccctgtgatccacaaggcc
caggagcttacgttgccggagatcgctcaggctattgttgatctggccgatcgcgcccgt
aacaataagctgaagccaaacgacctatccggcgcaaccttcactgtgaccaatatcggt
tccgagggtgccttggcagataccccaatcttggttccaccgcaggttggtatcttgggc
accgctgcgatccagaagcgcccagtggtaatcactgagaatggctcagacgccatcgca
atccgtcaaatgtgctacatcccgttctcttatgatcaccagatcgtagacggcgctgat
gccggtcgcttcaccgcgacgatcaaggatcgcctggaaaaggctaagttccaggacgac
ctcaacctctaa

DBGET integrated database retrieval system