KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1992Help
Entry
Cp316_1992        CDS       T01753                                 

Gene name
nagA
Definition
Beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp316_1992 (nagA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Cp316_1992 (nagA)
Enzymes [BR:cpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cp316_1992 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2098966..2100081)
Genome map
AA seq 371 aa AA seqDB search
MHMKRLLAAALLGVLAACSDAGTNTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAAS
LMMVGVSNYDDALAALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDLSVSTDFEG
GRVLRHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDV
VGDRAFSADPNIDAEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPSLGDLE
NIDLVPYGRINIPGAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGV
VYTDDLAMGAITGVMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQ
FEESVRRVGVV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgaaacgacttctcgccgccgccctcctcggtgtgctcgctgcatgtagcgac
gccggaaccaatacggatcccaccagcactgaggccaccactgcgttaacaacgcaggaa
accagcgcgcctgcaagcgcaaaaccacagcctgaggacgtccgcgctaaagccgcgagc
ctgatgatggtgggagtaagcaattacgacgacgcccttgctgccctaaaccaaggcgct
gggggtatcttcatagggtccggcaccgatcccaatcttctcaccgctccggatagaaac
attcaggcgctgcgtaaggccgtggggcgagacttgtctgtctcgaccgattttgaggga
gggcgtgttctccggcatcagggaattctgggcaccttcccctcgccccaagtgatggca
caaaccatgaaccccgagcaggttcgagggatggctaaagcgatgggcgactcattgctg
gctcatggagtgaccgtgaattttgctccggtcgcggatatagacgctggattagacgtt
gtgggcgatcgtgcctttagcgcagacccaaatattgatgcggaatacgccacagctttt
gcccaaggaatgcttgatgctggagtccggccagtgtttaagcacttcccggggcatggc
cgcgccagtggcgattcacacacaggacaggtattcacgccctctttaggtgacctggaa
aacattgacctagttccttatggccggattaatatccccggtgccggcgtgatgctcggg
catatggtggttcctgatctaggcgctccccagaacggacttccatccactctcaatccg
gccgcataccagttactacgcactggggcttatcgtgatgggcgtcctttcgccggcgtg
gtctacacggatgatcttgctatgggagcaatcaccggggttatgcctatccctcaagcc
gtagtggcctcgctgcaagctggcgcagatcaggctttgtgggtgaccactgcggggctt
aaagaagctatcgacgctaccgtggctgccgtggaaaccggcacgtatcccagggctcaa
tttgaagagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system