KEGG   Corynebacterium pseudotuberculosis 316: Cp316_2051Help
Entry
Cp316_2051        CDS       T01753                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp316_2051 (deoA)
Enzymes [BR:cpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp316_2051 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2175998..2177335
Genome map
AA seq 445 aa AA seqDB search
MPYSTSPALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMA
ALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLV
ASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAP
ADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELAR
TMVDLGRDAGTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEM
LELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEATADRDGYLTEMD
ALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALE
SLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgccatatagcacttccccagccttaacagctccaatggaaggtgataccgtggccgag
aaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagctaagcaaggga
caaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgatcaaatggct
gccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtccagtggacc
caggccatgatcgactccggcgagaccatgagctttgccagcctctcccggccaacaaca
gacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcgccactcgtt
gccagttacggcgttgccgtgccacaactctctggtagaggactaggacacacaggcgga
accctagacaaattagaggccatccccgggtgggaagctgacatagataatgcccgaatg
atgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggcctcgcaccc
gccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgcatcccgctg
atcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaacctagtcctcgac
gtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgagctcgcccgc
accatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctcaccgacatg
tccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtctgtagaagtc
ctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcgacggagatg
cttgaactcgccggcgtccatgaccccgatgtccacgaagcgcttgccgacggccgcgcg
atggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgcagcgctcccc
accgcacggcacacccatgaggccaccgccgatcgcgacggctatctcacagagatggac
gccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgcaaggaagat
ccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaaggtttcaaag
ggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccgagccctagaa
tccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccctcggtcatc
cttgatcgcatcagctaa

DBGET integrated database retrieval system