KEGG   Corynebacterium pseudotuberculosis 316: Cp316_2135Help
Entry
Cp316_2135        CDS       T01753                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00010  Glycolysis / Gluconeogenesis
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01120  Microbial metabolism in diverse environments
cpg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp316_2135
Enzymes [BR:cpg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Cp316_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFB73406
Position
complement(2267999..2268718)
Genome map
AA seq 239 aa AA seqDB search
MTTTFNMPEDRGHLISASTSACGEILFMSSIPDMALGGSIRGGVPIIAPWFGKLMGHKEL
QHGWARRQKWEVLETSGGLDARMSHDDWDLRLAVQSTPRGFAMMLKCRNASSVCRKLQLA
FHPYFYVSDVLDATVTAPGETFTTDGGLLEEFRLSAPTPLLIDDGQRLITVKGQGTDHFI
VWNPGEKLASEMSDMGTGEWRNFVCVEPALLGEDSEGVSVAPWDWVQIGMTVQVEAISR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacttttaacatgcccgaagatcgcggccaccttatctctgccagtacctct
gcctgcggtgaaatactctttatgtccagcattccagatatggcgctggggggttccatt
cgtggtggtgtgcccattattgctccgtggtttggcaaacttatggggcacaaggagctg
caacatggatgggcgcgccggcagaaatgggaggtgctagagacctcgggtgggctcgac
gctcgaatgagtcatgatgattgggacttgcgtttggcagtccagtcgacgccgcgaggt
tttgccatgatgctgaaatgtagaaacgcctcaagcgtttgccggaagcttcagttggcg
ttccatccatatttttatgtctctgacgttcttgatgccaccgtgaccgcccccggagag
acctttactacggacggtggtttgttggaggaatttcgcctctccgctcccacgcctttg
cttatcgacgacggccagcggctcattaccgttaaagggcaagggactgatcactttatt
gtgtggaaccccggcgagaaactggcgagtgagatgtccgatatgggcactggggaatgg
cgaaactttgtctgtgtagagcccgctctcctaggggaagactccgaaggggtttcggtg
gcgccgtgggattgggtacagattggtatgactgtgcaggttgaagcgatttctaggtga

DBGET integrated database retrieval system