KEGG   Corynebacterium pseudotuberculosis 316: Cp316_2150Help
Entry
Cp316_2150        CDS       T01753                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00260  Glycine, serine and threonine metabolism
cpg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01130  Biosynthesis of antibiotics
cpg01230  Biosynthesis of amino acids
Module
cpg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp316_2150 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp316_2150 (trpB)
Enzymes [BR:cpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp316_2150 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFB73421
Position
2284571..2285821
Genome map
AA seq 416 aa AA seqDB search
MTLSYNETTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFRKELASYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACTLLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEEEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacgaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcacttcttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcgcaaagaactagcgagctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aagggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcacacttttaaac
ctcgaatgcgtcatttacatgggggctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtagtgtccgtagattcaggttccgggacactcaaa
gatgccgtcaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacagcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacaaatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggcgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcgcagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggaa
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system