KEGG   Corynebacterium pseudotuberculosis 316: Cp316_2151Help
Entry
Cp316_2151        CDS       T01753                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp316_2151 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp316_2151 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp316_2151 (trpA)
Enzymes [BR:cpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp316_2151 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2285824..2286660
Genome map
AA seq 278 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLTDVVNNINKFGGAPVLLGFGISTPQHIREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEISLHLRMKAATRR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggcgcctttgtt
cccttcatcatgcttggagaccccagccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccttttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcttctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcaccgatgtggtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
atccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagatttcgcttcatctcagaatgaaagcggcgacccgcagataa

DBGET integrated database retrieval system