KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0142Help
Entry
Cpha266_0142      CDS       T00439                                 

Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_0142
Enzymes [BR:cph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cpha266_0142
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cpha266_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
161397..162785
Genome map
AA seq 462 aa AA seqDB search
MTKSDHSQRVDVSEKGYVYIIGAGPGDPELLTIKAERALQEADVLLYDDLVSGELVDQFQ
GIKIYTGKRKDSHHFEQDEINSEIVRHALMGKKVARLKGGDPFVFGRGGEEIEVLRKNGI
RYEIIPGITAAYGASAYTEIPLTMRKISSSVAFCTGHPVNKIQVPDADTLVYYMVASTVH
DVLDAVVSKGRSENTKVAIVQNATRYNQKIFTGTLGELRRREKAVYSPALLIIGDNINQF
IEKNWFSGKRKVLLTGGDAKRYNAMEHIMVHFPCRQVDGADRERVKEYFDDFSPYSTLLF
TSKFSVKYFFASLFEYGKDVRHLAAATICATGKAAALELQKHGVIPDLFFEPDGCADIVT
MFRERGMTDEHILLPGSNLVDEYLVRELTTLRNRVTPLCVYMHEAQEHAESIDLAFIDEI
YFASPSCVNNFRTLYSSIPENITVTAADTRTEKEYRSLFGES
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagagcgaccatagccaaagagttgacgtttctgaaaaagggtatgtttatatc
atcggcgcagggcctggcgatcctgaactgctgaccataaaggctgaacgcgccctccag
gaggccgacgtgcttctctatgacgacctggtgtcgggcgaacttgttgatcagtttcaa
ggcattaaaatctatacgggaaaacgcaaagacagccatcatttcgagcaggatgagatc
aacagcgaaatcgtccgccacgcactgatgggcaaaaaagtggcgaggctgaaagggggc
gatccatttgttttcgggcgcgggggtgaagagatcgaggtgctcagaaaaaacggtatc
aggtatgaaatcattcccggtatcacggcagcttacggcgcgagcgcctataccgaaata
ccgctgaccatgagaaaaatatcctcgtcggtggcgttctgtacgggacatccggtcaac
aagattcaggttcctgacgcagacacgctggtatactatatggtggcctcaaccgttcac
gatgttcttgatgccgttgtcagcaagggacgaagcgagaatacgaaagttgccattgtc
cagaacgcgaccaggtacaatcagaaaatttttaccggaacgctgggtgagttacggcgt
cgtgaaaaagcggtctactcgcccgcactcctgattatcggcgacaatatcaaccagttt
atcgagaagaactggttctccggtaaaaggaaggtgctgctgaccggaggggatgcaaag
cgatacaatgcaatggagcatatcatggtgcattttccctgccggcaggtcgatggcgcc
gacagagaaagggtaaaagagtattttgacgatttcagtccctacagcaccctgcttttt
accagcaagttttcggtgaaatatttctttgcctcattattcgagtatggcaaggatgtt
cgccatcttgcagcggcgaccatctgcgcaacgggaaaagccgcggctcttgaattgcag
aaacatggcgtgatccccgatttgtttttcgaacccgacggttgcgccgatatcgttacc
atgttcagggaacgcggcatgaccgatgagcatattctgcttcccggttcaaatctcgtt
gatgagtatcttgttcgtgaactgacaacgcttcgtaacagggtaaccccgctctgtgtc
tatatgcacgaagcacaggagcatgctgagagcatcgatcttgcgttcattgacgagatc
tatttcgcctctccgtcgtgcgtgaacaatttcagaacgctctacagcagcattcctgaa
aatataacggttacagcggccgatacaagaaccgaaaaggagtacagaagcctgtttggc
gaatcgtaa

DBGET integrated database retrieval system