KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0335Help
Entry
Cpha266_0335      CDS       T00439                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00260  Glycine, serine and threonine metabolism
cph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01130  Biosynthesis of antibiotics
cph01230  Biosynthesis of amino acids
Module
cph_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_0335
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpha266_0335
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpha266_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL64394
JGI: Cpha2660335
UniProt: A1BDB7
Position
complement(365166..366539)
Genome map
AA seq 457 aa AA seqDB search
MGTDLTKIILDEHEMPRQWYNIQADLPVPLPPPVGMDGTPISPDDLAQVFPMNLIEQEMS
TERWIDIPEEVLSILKLWRPSPLYRAKRLEKALGTPAKIFYKNEGVSPAGSHKPNTAVPQ
AWYNKQFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFMVRISFDQKPFRKIMMKTWGA
ECIASPSRETAIGRRILEEMPDTPGSLGIAISEAIEQAVEREDTRYALGSVLNHVMLHQS
IIGLEAQKQFEKIGLYPDVVIGCAGGGSNFAGISFPFICDKIHGKDIQIIATEPEACPTL
TKGPYIYDSGDVALMTPLLAMHSLGHGFIPPAIHAGGLRYHGMAPLVSHVKQLGLIEATA
LPQTECYEAALLFAHTEGFIPAPETSHAIAQTIREAKKAKEEGKERVILMNWSGHGLMDL
QGYDAFLSGKLSDYALPDELLQQSLAAVRNHPKPPGA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggtacagatctcaccaagatcattcttgacgaacatgaaatgccccgtcagtggtac
aacattcaggctgaccttcctgtaccattacccccgccagtgggcatggacggcaccccg
atatctcccgacgatctggcacaggtgtttccgatgaacctgattgagcaggagatgagc
accgagcgatggatagacatccctgaggaggtgctctcgatcctgaaactctggcgccct
tcgccgctctatcgtgcaaagcgtctcgaaaaagccctcggaactccggcaaaaatcttt
tataaaaacgaaggtgtttcgcctgcgggaagtcacaaaccaaacacggctgttccccag
gcatggtacaacaagcagttcggtataaaatatcttaccaccgaaaccggcgcagggcag
tggggcagcgctcttgcgatgagctgcaagcttatcggtattgagtgcaaggtctttatg
gttcgcatcagtttcgatcagaaaccgtttcgaaaaatcatgatgaaaacctggggcgca
gagtgcattgccagccccagccgcgaaacggcaatcggacgacgcattctggaggagatg
cctgatacaccgggaagcctcggtattgccataagcgaagcaatcgaacaggctgtagag
cgtgaggatacccgatatgctctcggcagcgtgctgaaccatgtgatgcttcaccagagc
atcatcggtcttgaagctcaaaaacagtttgaaaaaatcggactctaccccgacgtcgtt
atcgggtgcgcaggaggcggatcgaattttgccggcatcagttttcctttcatctgcgac
aagattcatggaaaagatattcagatcattgctaccgagcccgaagcctgcccgacgctg
accaaaggcccctatatttatgattccggagatgtggcattaatgactccgctgctcgcc
atgcacagtctcggtcacggcttcattcctcctgcgatacatgccggagggctccgctat
cacggcatggcgccactggtcagccatgtcaaacagctcggcctgattgaggcaaccgca
ctgccgcagacagagtgctatgaagccgctctgctgtttgcgcacaccgaaggctttatc
cctgcaccggaaacctctcacgctattgcgcaaaccatccgtgaagctaaaaaagcaaaa
gaggaaggaaaagaacgggttattctcatgaactggtccggccacggactcatggatctg
caaggctacgatgcctttctttccggcaaactcagcgattacgccctgccggatgagctt
ttgcaacaatcacttgccgcagtcaggaatcatcccaaaccgccaggcgcataa

DBGET integrated database retrieval system