KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0339Help
Entry
Cpha266_0339      CDS       T00439                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Brite
Enzymes [BR:cph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Cpha266_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_32 Methyltransf_31 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ABL64398
JGI: Cpha2660339
UniProt: A1BDC1
Position
369907..370557
Genome map
AA seq 216 aa AA seqDB search
MDSNSRLMTFRRREMVEKLKLSGIADNRVLAAFLSVERHRFFDKESQEYAYADGAYPIGY
GQTISQPYTVACMTSLLVERSPSGKVLEIGTGSGYQAAILYALGYRVYTIERVVELSEKA
EKLFSALGFSIMCRSGDGTLGWPEEAPFDGIMVTAGAPHCPETLLHQLALDGSLVVPIGA
HGLQKMTVFQRKKDRFEKEVFSDFAFVPLIGREGWG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatagtaattccaggctcatgacgttcaggcgcagagagatggttgaaaagctgaag
ttgagcggtattgcagataaccgggttcttgctgcgtttttaagtgttgaacgtcaccgt
ttttttgacaaggaaagtcaggagtatgcgtatgcggatggagcatatcccatagggtat
ggccagaccatttcgcagccctatacagtagcctgtatgacatcgttgcttgtggaacga
tcgccgtcaggtaaagttctcgaaatagggactggatcggggtatcaggcagcgattctt
tacgctctcgggtacagggtttatactattgagcgggttgtggaactctctgaaaaagcc
gaaaagctcttcagtgctctggggttctctataatgtgccgatcaggagacggaacgctc
ggctggcccgaggaggcgccgtttgacggtattatggttacagctggagcgcctcattgt
cccgaaacgctcttgcatcagcttgctctcgacgggagccttgttgtgccgattggagcg
catggtttgcagaaaatgacggtttttcaaagaaaaaaagaccgtttcgaaaaggaagta
ttcagtgattttgctttcgtgccgctgataggcagggaagggtggggttga

DBGET integrated database retrieval system