KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0375Help
Entry
Cpha266_0375      CDS       T00439                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cph00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
418378..418962
Genome map
AA seq 194 aa AA seqDB search
MTISRGPTGKLVVFSAPSGTGKSTIAKIVLERIPSLAFSVSATTRPMRAGEEEGVHYYFL
DKKKFEEKIRDGGFIEHEYFFNNYYGTLLDKTVDAVNSGHHLLFDLDVKGALNLKTLFPL
NSLLIFIRPPDMATLRERLLKRESEDADALNVRLERAELELGYVDQFDEVIVNDCLDRAA
DAVTAKVSEFLSNT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcagcagagggccgacgggaaagctcgtggttttttcagctccgtcgggaaca
ggaaagtcaacgattgcgaaaattgttcttgaacgaattccttcgctcgctttttccgta
tcggcaacaacaagaccgatgcgtgctggtgaggaggaaggggttcattattattttctt
gataaaaagaagtttgaagagaagattcgtgacggcgggtttatagagcatgaatatttt
ttcaataactactatggcacattgctcgataaaacggttgatgcggttaattcgggccat
catctgctttttgatctcgacgtcaagggtgctttgaatctgaaaactctttttcctctt
aattcattattgatatttataaggcctcctgatatggcaactctcagagagagattgtta
aagcgggaaagcgaagatgcggatgcattgaatgttcgtcttgagcgggctgaacttgaa
cttggttatgttgatcagttcgatgaggtgattgttaatgattgtctcgaccgggcggcc
gatgccgttacggcgaaagtaagtgagtttctttcaaacacgtaa

DBGET integrated database retrieval system